Antibody Information
General Information of This Antibody
| Antibody ID | ANI0OCOCW |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | SC16.3 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 (CD38) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
QVTLKESGPGILQPSATLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDVKR
YNPALKSRLTISKDTSSSQVFLKIASVDTADTATYYCARIADYGGDYYAMDYWGQGTSVT VSS Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
TSGMGVG
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
HIWWDDVKRYNPALKS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
IADYGGDYYAMDY
Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
QIVLTQSPAIMSVSLGERVTMTCTASSSVSSSYLHWYQQKPGSSPKLWIYSTSNLASGVP
ARFSGSGSGTSYFFTISSMEAEDAATYYCHQYHRSPFTFGAGTKLKIR Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
TASSSVSSSYLH
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
STSNLAS
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
HQYHRSPFT
Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
STI-6129 [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Patients with relapsed/refractory (RR) myeloma.
|
||||
| Administration Dosage |
Dose range from 0.25 mg/kg to 3.68 mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05565807 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
A phase 1b/2a, open-label, dose-escalation and extension study to evaluate the safety and efficacy of an anti-CD38 antibody drug conjugate (STI-6129) in patients with relapsed or refractory multiple myeloma.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05308225 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
A phase 1b/2a, open-label, dose-escalation study of the safety and efficacy of an anti-CD38 antibody drug conjugate (STI-6129) in patients with relapsed or refractory multiple myeloma.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT04316442 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
A phase 1b/2a, open-label, dose-escalation study of the safety and efficacy of an anti-CD38 antibody drug conjugate (STI-6129) in patients with relapsed or refractory systemic al amyloidosis.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [4] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05692908 | Clinical Status | Phase 1 | ||
| Clinical Description |
An open-label, dose-escalation study of the safety of an anti-CD38 antibody drug conjugate (STI-6129) in patients with relapsed or refractory systemic al amyloidosis.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [5] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05584709 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1b, open-label, dose-escalation study of the safety and efficacy of an anti-CD38 antibody drug conjugate (STI-6129) in patients with advanced solid tumors.
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [6] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05519527 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study of safety and efficacy of an anti-CD38 antibody drug conjugate (STI-6129) in patients with relapsed or refractory t-acute lymphoblastic leukemia/lymphoma (T-ALL) or acute myeloid leukemia (AML).
|
||||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.