Antigen ID	TAR0BKUOF
Antigen Name	B-lymphocyte antigen CD20 (MS4A1)
Gene Name	MS4A1
Gene ID	931
Synonym	CD20; B-lymphocyte surface antigen B1;Bp35;Leukocyte surface antigen Leu-16;Membrane-spanning 4-domains subfamily A member 1;CD_antigen=CD20
Sequence	MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP     Click to Show/Hide
Family	MHC class II family
Function	B-lymphocyte-specific membrane protein that plays a role in the regulation of cellular calcium influx necessary for the development, differentiation, and activation of B-lymphocytes. Functions as a store-operated calcium (SOC) channel component promoting calcium influx after activation by the B-cell receptor/BCR.     Click to Show/Hide
Uniprot Entry	CD20_HUMAN
HGNC ID	HGNC:7315
KEGG ID	hsa:931

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CD20-A Antibody-Compound (X)	CD20-A Antibody-Compound (X) payload	Undisclosed	CD20-A Antibody-Compound (X) linker	[1]
ADC Info	CD20-A Antibody-Compound (XI)	CD20-A Antibody-Compound (XI) payload	Undisclosed	CD20-A Antibody-Compound (XI) linker	[1]
ADC Info	CD20-A Antibody-Compound (XIV)	CD20-A Antibody-Compound (XIV) payload	Undisclosed	CD20-A Antibody-Compound (XIV) linker	[1]
ADC Info	CD20-A Antibody-Compound (XVIII)	CD20-A Antibody-Compound (XVIII) payload	Undisclosed	CD20-A Antibody-Compound (XVIII) linker	[1]
ADC Info	CD20-A Antibody-Compound (Ie)	CD20-A Antibody-Compound (Ie) payload	Undisclosed	CD20-A Antibody-Compound (Ie) linker	[1]
ADC Info	CD20-A Antibody-Compound (XIX)	CD20-A Antibody-Compound (XIX) payload	Undisclosed	CD20-A Antibody-Compound (XIX) linker	[1]
ADC Info	CD20-A Antibody-Compound (Ii)	CD20-A Antibody-Compound (Ii) payload	Undisclosed	CD20-A Antibody-Compound (Ii) linker	[1]
ADC Info	CD20-A Antibody-Compound (XLI)	CD20-A Antibody-Compound (XLI) payload	Undisclosed	CD20-A Antibody-Compound (XLI) linker	[1]
ADC Info	CD20-A Antibody-Compound (XVI)	CD20-A Antibody-Compound (XIX) payload	Undisclosed	CD20-A Antibody-Compound (XIX) linker	[1]
ADC Info	CD20-A Antibody-Compound (XL)	CD20-A Antibody-Compound (XL) payload	Undisclosed	CD20-A Antibody-Compound (XL) linker	[1]
ADC Info	CD20-A Antibody-Compound (XLII)	CD20-A Antibody-Compound (XLII) payload	Undisclosed	CD20-A Antibody-Compound (XLII) linker	[1]
ADC Info	CD20-A Antibody-Compound (XV)	CD20-A Antibody-Compound (XV) payload	Undisclosed	CD20-A Antibody-Compound (XV) linker	[1]
ADC Info	CD20-A Antibody-Compound (XLIII)	CD20-A Antibody-Compound (XLIII) payload	Undisclosed	CD20-A Antibody-Compound (XLIII) linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	MRG-001	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Ibritumomab-Compound 9	Mertansine DM1	Microtubule (MT)	Ibritumomab-Compound 9 linker	[3]
ADC Info	Ibritumomab-Compound 17	Mertansine DM4	Microtubule (MT)	Ibritumomab-Compound 17 linker	[3]
ADC Info	Ibritumomab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Ibritumomab-Compound 25 linker	[3]
ADC Info	Ibritumomab-Compound 31	Auristatin 0101	Microtubule (MT)	Ibritumomab-Compound 31 linker	[3]
ADC Info	Ibritumomab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Ibritumomab-Compound 36 linker	[3]
ADC Info	Ibritumomab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Ibritumomab-Compound 43 linker	[3]
ADC Info	Ibritumomab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Ibritumomab-Compound 49 linker	[3]
ADC Info	Ibritumomab-Compound 55	Mertansine DM1	Microtubule (MT)	Ibritumomab-Compound 55 linker	[3]
ADC Info	Ibritumomab-Compound 59	Mertansine DM4	Microtubule (MT)	Ibritumomab-Compound 59 linker	[3]
ADC Info	Ibritumomab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Ibritumomab-Compound 64 linker	[3]
ADC Info	Ibritumomab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Ibritumomab-Compound 69 linker	[3]
ADC Info	Ibritumomab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Ibritumomab-Compound 74 linker	[3]
ADC Info	Ibritumomab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Ibritumomab-Compound 75 linker	[3]
ADC Info	Ibritumomab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Ibritumomab-Compound 76 linker	[3]
ADC Info	Ibritumomab-Compound 77	Mertansine DM1	Microtubule (MT)	Ibritumomab-Compound 77 linker	[3]
ADC Info	Ibritumomab-Compound 78	Auristatin 0101	Microtubule (MT)	Ibritumomab-Compound 78 linker	[3]
ADC Info	Ibritumomab-Compound 79	Auristatin 0101	Microtubule (MT)	Ibritumomab-Compound 79 linker	[3]
ADC Info	Ibritumomab-Compound 80	Mertansine DM4	Microtubule (MT)	Ibritumomab-Compound 80 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Ofatumumab-Compound 9	Mertansine DM1	Microtubule (MT)	Ofatumumab-Compound 9 linker	[3]
ADC Info	Ofatumumab-Compound 17	Mertansine DM4	Microtubule (MT)	Ofatumumab-Compound 17 linker	[3]
ADC Info	Ofatumumab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Ofatumumab-Compound 25 linker	[3]
ADC Info	Ofatumumab-Compound 31	Auristatin 0101	Microtubule (MT)	Ofatumumab-Compound 31 linker	[3]
ADC Info	Ofatumumab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Ofatumumab-Compound 36 linker	[3]
ADC Info	Ofatumumab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Ofatumumab-Compound 43 linker	[3]
ADC Info	Ofatumumab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Ofatumumab-Compound 49 linker	[3]
ADC Info	Ofatumumab-Compound 55	Mertansine DM1	Microtubule (MT)	Ofatumumab-Compound 55 linker	[3]
ADC Info	Ofatumumab-Compound 59	Mertansine DM4	Microtubule (MT)	Ofatumumab-Compound 59 linker	[3]
ADC Info	Ofatumumab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Ofatumumab-Compound 64 linker	[3]
ADC Info	Ofatumumab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Ofatumumab-Compound 69 linker	[3]
ADC Info	Ofatumumab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Ofatumumab-Compound 74 linker	[3]
ADC Info	Ofatumumab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Ofatumumab-Compound 75 linker	[3]
ADC Info	Ofatumumab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Ofatumumab-Compound 76 linker	[3]
ADC Info	Ofatumumab-Compound 77	Mertansine DM1	Microtubule (MT)	Ofatumumab-Compound 77 linker	[3]
ADC Info	Ofatumumab-Compound 78	Auristatin 0101	Microtubule (MT)	Ofatumumab-Compound 78 linker	[3]
ADC Info	Ofatumumab-Compound 79	Auristatin 0101	Microtubule (MT)	Ofatumumab-Compound 79 linker	[3]
ADC Info	Ofatumumab-Compound 80	Mertansine DM4	Microtubule (MT)	Ofatumumab-Compound 80 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Rituximab-Compound (la) DAR 8	NeoDegrader P1	Protein cereblon (CRBN)	Rituximab-Compound (la) linker	[4]
ADC Info	Rituximab-Compound (lc)	NeoDegrader P4	Protein cereblon (CRBN)	Rituximab-Compound (lc) linker	[4]
ADC Info	Rituximab-Compound (le)	NeoDegrader P1	Protein cereblon (CRBN)	Rituximab-Compound (le) linker	[4]
ADC Info	Rituximab-Compound (lf)	NeoDegrader P6	Protein cereblon (CRBN)	Rituximab-Compound (lf) linker	[4]
ADC Info	Rituximab-Compound (lg)	NeoDegrader P2	Protein cereblon (CRBN)	Rituximab-Compound (lg) linker	[4]
ADC Info	Rituximab-Compound (lh)	NeoDegrader P13	Protein cereblon (CRBN)	Rituximab-Compound (lh) linker	[4]
ADC Info	Rituximab-Compound (li)	NeoDegrader P1	Protein cereblon (CRBN)	Rituximab-Compound (li) linker	[4]
ADC Info	Rituximab-Compound (lk)	NeoDegrader P14	Protein cereblon (CRBN)	Rituximab-Compound (lk) linker	[4]
ADC Info	Rituximab-Compound (ll)	NeoDegrader P14	Protein cereblon (CRBN)	Rituximab-Compound (ll) linker	[4]
ADC Info	Rituximab-Compound (lm)	NeoDegrader P14	Protein cereblon (CRBN)	Rituximab-Compound (lm) linker	[4]
ADC Info	Rituximab-Compound (la) DAR 4	NeoDegrader P1	Protein cereblon (CRBN)	Rituximab-Compound (la) linker	[4]
ADC Info	WO2017089895A1 ADC70	Monomethyl auristatin F	Microtubule (MT)	WO2017089895A1_ADC70 linker	[5]
ADC Info	WO2017089895A1 ADC71	Monomethyl auristatin E	Microtubule (MT)	WO2017089895A1_ADC71 linker	[5]
ADC Info	WO2017089895A1 ADC72	Monomethyl auristatin F	Microtubule (MT)	WO2017089895A1_ADC72 linker	[5]
ADC Info	Rituximab-Compound (X)	Rituximab-Compound (X) payload	Undisclosed	Rituximab-Compound (X) linker	[1]
ADC Info	Rituximab-Compound (XI)	Rituximab-Compound (XI) payload	Undisclosed	Rituximab-Compound (XI) linker	[1]
ADC Info	Rituximab-Compound (XIV)	Rituximab-Compound (XIV) payload	Undisclosed	Rituximab-Compound (XIV) linker	[1]
ADC Info	Rituximab-Compound (XVIII)	Rituximab-Compound (XVIII) payload	Undisclosed	Rituximab-Compound (XVIII) linker	[1]
ADC Info	Rituximab-Compound (Ie)	Rituximab-Compound (Ie) payload	Undisclosed	Rituximab-Compound (Ie) linker	[1]
ADC Info	Rituximab-Compound (XIX)	Rituximab-Compound (XIX) payload	Undisclosed	Rituximab-Compound (XIX) linker	[1]
ADC Info	Rituximab-Compound (Ii)	Rituximab-Compound (Ii) payload	Undisclosed	Rituximab-Compound (Ii) linker	[1]
ADC Info	Rituximab-Compound (XLI)	Rituximab-Compound (XLI) payload	Undisclosed	Rituximab-Compound (XLI) linker	[1]
ADC Info	Rituximab-Compound (XVI)	Rituximab-Compound (XIX) payload	Undisclosed	Rituximab-Compound (XIX) linker	[1]
ADC Info	Rituximab-Compound (XL)	Rituximab-Compound (XL) payload	Undisclosed	Rituximab-Compound (XL) linker	[1]
ADC Info	Rituximab-Compound (XLII)	Rituximab-Compound (XLII) payload	Undisclosed	Rituximab-Compound (XLII) linker	[1]
ADC Info	Rituximab-Compound (XV)	Rituximab-Compound (XV) payload	Undisclosed	Rituximab-Compound (XV) linker	[1]
ADC Info	EDC-9	Undisclosed	Undisclosed	Undisclosed	[6]
ADC Info	Rituximab-DNA conjugate	DNA mimics	Human Deoxyribonucleic acid (hDNA)	Undisclosed	[7]
ADC Info	Rituximab-Compound (lj)	NeoDegrader P1	Protein cereblon (CRBN)	Rituximab-Compound (lj) linker	[4]
ADC Info	Rituximab-Compound (XLIII)	Rituximab-Compound (XLIII) payload	Undisclosed	Rituximab-Compound (XLIII) linker	[1]
ADC Info	WO2017089890A1 ADC70	Monomethyl auristatin F	Microtubule (MT)	WO2017089890A1_ADC70 linker	[8]
ADC Info	WO2017089890A1 ADC71	Monomethyl auristatin E	Microtubule (MT)	WO2017089890A1_ADC71 linker	[8]
ADC Info	WO2017089890A1 ADC72	Monomethyl auristatin F	Microtubule (MT)	WO2017089890A1_ADC72 linker	[8]
ADC Info	Rituximab-Compound 9	Mertansine DM1	Microtubule (MT)	Rituximab-Compound 9 linker	[3]
ADC Info	Rituximab-Compound 17	Mertansine DM4	Microtubule (MT)	Rituximab-Compound 17 linker	[3]
ADC Info	Rituximab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Rituximab-Compound 25 linker	[3]
ADC Info	Rituximab-Compound 31	Auristatin 0101	Microtubule (MT)	Rituximab-Compound 31 linker	[3]
ADC Info	Rituximab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Rituximab-Compound 36 linker	[3]
ADC Info	Rituximab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Rituximab-Compound 43 linker	[3]
ADC Info	Rituximab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Rituximab-Compound 49 linker	[3]
ADC Info	Rituximab-Compound 55	Mertansine DM1	Microtubule (MT)	Rituximab-Compound 55 linker	[3]
ADC Info	Rituximab-Compound 59	Mertansine DM4	Microtubule (MT)	Rituximab-Compound 59 linker	[3]
ADC Info	Rituximab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Rituximab-Compound 64 linker	[3]
ADC Info	Rituximab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Rituximab-Compound 69 linker	[3]
ADC Info	Rituximab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Rituximab-Compound 74 linker	[3]
ADC Info	Rituximab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Rituximab-Compound 75 linker	[3]
ADC Info	Rituximab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Rituximab-Compound 76 linker	[3]
ADC Info	Rituximab-Compound 77	Mertansine DM1	Microtubule (MT)	Rituximab-Compound 77 linker	[3]
ADC Info	Rituximab-Compound 78	Auristatin 0101	Microtubule (MT)	Rituximab-Compound 78 linker	[3]
ADC Info	Rituximab-Compound 79	Auristatin 0101	Microtubule (MT)	Rituximab-Compound 79 linker	[3]
ADC Info	Rituximab-Compound 80	Mertansine DM4	Microtubule (MT)	Rituximab-Compound 80 linker	[3]
ADC Info	CN109310885B ADC-7	CN109310885B ADC-7 payload	Undisclosed	CN109310885B ADC-7 linker	[9]
ADC Info	CN109310885B ADC-8	CN109310885B ADC-8 payload	Undisclosed	CN109310885B ADC-8 linker	[9]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Tositumomab-Compound 9	Mertansine DM1	Microtubule (MT)	Tositumomab-Compound 9 linker	[3]
ADC Info	Tositumomab-Compound 17	Mertansine DM4	Microtubule (MT)	Tositumomab-Compound 17 linker	[3]
ADC Info	Tositumomab-Compound 25	Monomethyl auristatin E	Microtubule (MT)	Tositumomab-Compound 25 linker	[3]
ADC Info	Tositumomab-Compound 31	Auristatin 0101	Microtubule (MT)	Tositumomab-Compound 31 linker	[3]
ADC Info	Tositumomab-Compound 36	Monomethyl auristatin E	Microtubule (MT)	Tositumomab-Compound 36 linker	[3]
ADC Info	Tositumomab-Compound 43	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Tositumomab-Compound 43 linker	[3]
ADC Info	Tositumomab-Compound 49	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Tositumomab-Compound 49 linker	[3]
ADC Info	Tositumomab-Compound 55	Mertansine DM1	Microtubule (MT)	Tositumomab-Compound 55 linker	[3]
ADC Info	Tositumomab-Compound 59	Mertansine DM4	Microtubule (MT)	Tositumomab-Compound 59 linker	[3]
ADC Info	Tositumomab-Compound 64	Monomethyl auristatin E	Microtubule (MT)	Tositumomab-Compound 64 linker	[3]
ADC Info	Tositumomab-Compound 69	Monomethyl auristatin E	Microtubule (MT)	Tositumomab-Compound 69 linker	[3]
ADC Info	Tositumomab-Compound 74	PBD dimer	Human Deoxyribonucleic acid (hDNA)	Tositumomab-Compound 74 linker	[3]
ADC Info	Tositumomab-Compound 75	Monomethyl auristatin E	Microtubule (MT)	Tositumomab-Compound 75 linker	[3]
ADC Info	Tositumomab-Compound 76	Monomethyl auristatin E	Microtubule (MT)	Tositumomab-Compound 76 linker	[3]
ADC Info	Tositumomab-Compound 77	Mertansine DM1	Microtubule (MT)	Tositumomab-Compound 77 linker	[3]
ADC Info	Tositumomab-Compound 78	Auristatin 0101	Microtubule (MT)	Tositumomab-Compound 78 linker	[3]
ADC Info	Tositumomab-Compound 79	Auristatin 0101	Microtubule (MT)	Tositumomab-Compound 79 linker	[3]
ADC Info	Tositumomab-Compound 80	Mertansine DM4	Microtubule (MT)	Tositumomab-Compound 80 linker	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Veltuzumab-SN-38	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2A	[10]
ADC Info	Veltuzumab-CL2E-SN-38	Active metabolite of irinotecan SN38	DNA topoisomerase 1 (TOP1)	CL2E	[10]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CON-4619	Undisclosed	Undisclosed	Undisclosed	[11]
ADC Info	TRS-005	Undisclosed	Undisclosed	Undisclosed	[12]
ADC Info	APEC-1	Undisclosed	Undisclosed	Undisclosed	[13]
ADC Info	B-1452	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[14]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.40E-12; Fold-change: 1.216703593; Z-score: 1.315769335
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.712709155; Fold-change: 0.014223714; Z-score: 0.176213606
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.822410822; Fold-change: -0.127909132; Z-score: -0.85850914
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.017084588; Fold-change: -0.47626011; Z-score: -0.997662838
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001365585; Fold-change: 0.052722889; Z-score: 0.113746929
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.91E-22; Fold-change: -1.739907356; Z-score: -2.950512191
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000353647; Fold-change: -3.014152593; Z-score: -5.740869331
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.30E-05; Fold-change: -0.441996334; Z-score: -1.010247845
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.03525625; Fold-change: -2.318015384; Z-score: -1.834018106
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.723884372; Fold-change: 0.218856769; Z-score: 0.293414319
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.150148092; Fold-change: -1.883888996; Z-score: -1.663341262
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000803619; Fold-change: -1.788783853; Z-score: -1.181988183
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.58E-20; Fold-change: -1.380161265; Z-score: -0.86077679
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.07E-11; Fold-change: -0.850297489; Z-score: -0.576412537
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.567307243; Fold-change: 0.074793973; Z-score: 0.034427405
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.383767432; Fold-change: 0.206647516; Z-score: 0.089392326
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.100022711; Fold-change: -0.084884064; Z-score: -0.331477504
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000185179; Fold-change: -0.31548436; Z-score: -0.639808613
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.923256193; Fold-change: -0.145737636; Z-score: -0.463161902
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.04E-13; Fold-change: 0.834017441; Z-score: 0.698157434
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.02E-11; Fold-change: 0.691989723; Z-score: 0.709787757
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.86E-06; Fold-change: 0.777750607; Z-score: 1.029113437
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.52E-07; Fold-change: 0.019590703; Z-score: 0.088036495
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.655020462; Fold-change: -0.168424499; Z-score: -8.291447933
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.00E-41; Fold-change: 0.185942743; Z-score: 0.385775823
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.015524495; Fold-change: 0.11415017; Z-score: 0.121297024
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.49662401; Fold-change: -0.199009328; Z-score: -0.428283765
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.402248565; Fold-change: -0.336051074; Z-score: -0.95759095
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.320974831; Fold-change: -0.013257905; Z-score: -0.052967459
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.007921513; Fold-change: -0.053430793; Z-score: -0.129231948
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.00056827; Fold-change: 0.57938241; Z-score: 2.328043681
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.174064176; Fold-change: -0.515081306; Z-score: -0.316445778
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.381522523; Fold-change: 0.352947233; Z-score: 0.297186786
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.10009362; Fold-change: 0.075716129; Z-score: 1.220239244
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.327599854; Fold-change: 0.198760936; Z-score: 0.083906233
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.387521481; Fold-change: 0.229327102; Z-score: 0.119121831
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.685543789; Fold-change: -0.050099287; Z-score: -0.653392594
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.086758129; Fold-change: 1.089617172; Z-score: 0.460446436
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.716803812; Fold-change: 0.078806956; Z-score: 0.253300043
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.945031508; Fold-change: -0.056284717; Z-score: -0.162242802
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.84968763; Fold-change: -1.565595288; Z-score: -0.65010836
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002919926; Fold-change: -0.364713632; Z-score: -0.278840746
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.874495557; Fold-change: -0.050686514; Z-score: -0.162454579
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.17E-08; Fold-change: -3.900590421; Z-score: -2.318447457
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.888022229; Fold-change: 0.041585535; Z-score: 0.243334723
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.483171961; Fold-change: 0.152805595; Z-score: 1.269780411
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.998229558; Fold-change: 0.195171828; Z-score: 0.213417357
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.194365942; Fold-change: 0.258016057; Z-score: 1.753972755
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.13E-06; Fold-change: -0.561445736; Z-score: -1.073179795
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.662845608; Fold-change: -0.169886965; Z-score: -0.138758177
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.155963909; Fold-change: -0.038867531; Z-score: -0.15657478
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.070422778; Fold-change: 1.515304039; Z-score: 2.194182361
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.986061067; Fold-change: 0.424587373; Z-score: 0.388819303
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.20E-11; Fold-change: -1.52660992; Z-score: -1.103806894
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.18E-46; Fold-change: -1.652337489; Z-score: -1.559057456
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.018485145; Fold-change: -0.538012342; Z-score: -0.859171363
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.324851468; Fold-change: -0.964710772; Z-score: -2.448370949
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.392639083; Fold-change: 0.036453804; Z-score: 0.044623166
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.338053662; Fold-change: -0.637083142; Z-score: -0.289391484
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.260901571; Fold-change: 0.005583445; Z-score: 0.013131282
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.579529783; Fold-change: -0.071022014; Z-score: -0.084298549
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.246351834; Fold-change: 0.058436213; Z-score: 0.275770923
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.57708459; Fold-change: 0.071540765; Z-score: 0.101704429
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.163221069; Fold-change: 2.129959948; Z-score: 5.681434118
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.138529937; Fold-change: -0.301923311; Z-score: -0.924848792
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.078675406; Fold-change: 0.296771962; Z-score: 1.462548221
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.328506396; Fold-change: 0.171395182; Z-score: 0.18421621
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000254771; Fold-change: -0.085037678; Z-score: -0.19905966
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.067728183; Fold-change: 0.120697949; Z-score: 0.165505128
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.708045884; Fold-change: -0.022514188; Z-score: -0.032269094
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001880484; Fold-change: 0.886657418; Z-score: 1.808683076
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.65E-10; Fold-change: 1.200841496; Z-score: 1.304531564
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.990850078; Fold-change: -0.401264683; Z-score: -0.712102154
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 7.70E-06; Fold-change: 1.187958151; Z-score: 4.112338896
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.43E-05; Fold-change: 0.984825161; Z-score: 1.510808647
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.20647983; Fold-change: 0.06534649; Z-score: 0.03776449
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.024017273; Fold-change: 0.071105654; Z-score: 0.242243799
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.509860208; Fold-change: -0.040565887; Z-score: -0.14132477
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.83E-25; Fold-change: 0.515283293; Z-score: 1.816391091
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.126794592; Fold-change: -0.277605939; Z-score: -0.855940764
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.018010037; Fold-change: 0.209085793; Z-score: 0.311698275
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.798636167; Fold-change: -0.038415224; Z-score: -0.098363703
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.829929867; Fold-change: -0.013392292; Z-score: -0.054126081
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.698703934; Fold-change: -0.223322055; Z-score: -0.345748833
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.951197645; Fold-change: 0.07688488; Z-score: 0.138641118
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.040029292; Fold-change: 0.248758908; Z-score: 0.563360764
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.167020645; Fold-change: -0.240931448; Z-score: -0.31494915
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.206937392; Fold-change: 0.131361242; Z-score: 1.133907868
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.1869272; Fold-change: 0.323647971; Z-score: 0.977957202
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.002282485; Fold-change: 3.969808494; Z-score: 2.590161081
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.125888508; Fold-change: -0.167777774; Z-score: -0.723463666
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.06E-30; Fold-change: -1.950320686; Z-score: -1.269513458
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.044451567; Fold-change: -0.728719237; Z-score: -1.54010728
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.153986639; Fold-change: 0.032626533; Z-score: 0.204607179
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.925035726; Fold-change: 0.075312087; Z-score: 0.052763329
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.320103572; Fold-change: -0.083168066; Z-score: -0.084817123
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.057676692; Fold-change: -1.888133123; Z-score: -1.234848879
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.244628948; Fold-change: -0.656351587; Z-score: -0.481853717
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.047064581; Fold-change: -1.786672914; Z-score: -1.421597692
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.14E-29; Fold-change: 0.683114573; Z-score: 1.479986786
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.10E-41; Fold-change: 1.016961659; Z-score: 2.368773576
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00157132; Fold-change: 0.117830818; Z-score: 0.474667145
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.249554837; Fold-change: -0.242640762; Z-score: -0.385062914
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.237401496; Fold-change: -0.202519707; Z-score: -0.818217249
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.271294134; Fold-change: -0.187430744; Z-score: -1.660131291
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.170821227; Fold-change: 0.081955621; Z-score: 0.624737608
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.51481739; Fold-change: -0.683204939; Z-score: -0.493936034
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.499511545; Fold-change: -0.777629184; Z-score: -0.802899422
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.56E-05; Fold-change: -0.63700321; Z-score: -1.201965685
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.11E-08; Fold-change: -2.090662208; Z-score: -3.547420246
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.787638636; Fold-change: -0.977282137; Z-score: -0.673081188
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.001010061; Fold-change: 1.275611118; Z-score: 4.440124437
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.241658144; Fold-change: -0.9303581; Z-score: -0.932813523
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003480785; Fold-change: -0.347656672; Z-score: -0.845483951
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.985177101; Fold-change: 0.136117637; Z-score: 0.218291815
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.41695012; Fold-change: -0.049126772; Z-score: -0.384608856
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.477965615; Fold-change: 0.06439992; Z-score: 0.202819803
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.189016426; Fold-change: -0.031245271; Z-score: -0.233709723
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.695532482; Fold-change: 0.624249052; Z-score: 1.200500399
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.144859215; Fold-change: -0.120786224; Z-score: -0.175226579
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.023079021; Fold-change: -0.163538991; Z-score: -0.27725982
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.027445971; Fold-change: 0.038450741; Z-score: 0.539669446
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.969477236; Fold-change: -0.126589189; Z-score: -0.128362436
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.968740191; Fold-change: -0.006823825; Z-score: -0.031064468
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.774185603; Fold-change: 0.373969869; Z-score: 0.429648344
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.25841382; Fold-change: 0.176360808; Z-score: 0.937511057
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.991201675; Fold-change: -0.043734917; Z-score: -0.159948453
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.025410278; Fold-change: 0.138806267; Z-score: 1.080750904
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.006783579; Fold-change: 0.183174411; Z-score: 1.031779028
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Linkers for use in antibody drug conjugates; 2023-03-16.
Ref 2	A Dose Escalation Phase Ia Study of Anti-CD20 Antibody Drug Conjugate, MRG001 in Relapsed/Refractory Advanced Non-Hodgkin Lymphom. Blood. 2021 ;138():-. doi: 10.1182/blood-2021-144829.
Ref 3	Covalent linkers in antibody-drug conjugates and methods of making and using the same.
Ref 4	Neodegrader conjugates; 2021-10-07.
Ref 5	Antibody-drug conjugates comprising branched linkers and methods related thereto; 2017-06-01.
Ref 6	EDC technology company product EDC9
Ref 7	Aptamer-Directed Conjugation of DNA to Therapeutic Antibodies. Bioconjug Chem. 2019 Aug 21;30(8):2127-2135. doi: 10.1021/acs.bioconjchem.9b00363. Epub 2019 Jul 12.
Ref 8	Conjugates comprising self-immolative groups and methods related thereto.
Ref 9	NaPi2b targeting antibody-drug conjugates and methods of use thereof.
Ref 10	Epratuzumab-SN-38: a new antibody-drug conjugate for the therapy of hematologic malignancies. Mol Cancer Ther. 2012 Jan;11(1):224-34. doi: 10.1158/1535-7163.MCT-11-0632. Epub 2011 Oct 28.
Ref 11	Open-label Study of Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Auriim.
Ref 12	A phase 1 study of TRS005 in patients with R/R CD20-positive B-NHL.
Ref 13	Introduction to basic information on ADC drug APEC-1.
Ref 14	Tasly pharma announcement; 2020