General Information of This Antibody (ID: ANI0YRYTW)
Antibody Name
Rituximab
Brand Name
MABTHERA; RITUXAN
Organization
Biogen, Inc.
Indication
Chronic lymphocytic leukemia; Rheumatoid arthritis; Non-Hodgkin's lymphoma; Pemphigus vulgaris
Approval Date
Nov. 1997
Synonyms
IDEC-C2B8; ABP798; ABP-798; BI695500; BI 695500; BI-695500; BLITZIMA; CT-P10; GP2013; HS006; HS-006; HS-006 (RITUXIMAB BIOSIMILAR); IDEC-102; IDEC-C2B8; MK-8808; PF-05280586; R-105 IDEC-102; RG-105; RHCACD20MA; RIABNI; RITEMVIA; RITUXIMAB ABBS; RITUXIMAB-ABBS; RITUXIMAB ARRX; RITUXIMAB-ARRX; RITUXIMAB BIOSIMILAR-CELLTRION; RITUXIMAB BIOSIMILAR-MERCK; RITUXIMAB-BOEHRINGER INGELHEIM; RITUXIMAB-CT-P10; RITUXIMAB (GENETICAL RECOMBINATION); RITUXIMAB-PFIZER; RITUXIMAB PVVR; RITUXIMAB-PVVR; RUXIENCE; SAIT101; SAIT-101; TRUXIMA; TUXELLA; USP MAB 001; MONOCLONAL IGG1 ZUBERITAMAB; MABTHERA; MABTHERA RITUXAN; Rituxan
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Chimeric IgG1-kappa
Antigen Name
B-lymphocyte antigen CD20 (MS4A1)
 Antigen Info 
ChEMBI ID
CHEMBL1201576
PDB ID
1l6x , 2osl , 4kaq , 6vja
DrugBank ID
DB00073
Drug Central ID
4975
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY
NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS
AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Varible Domain
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY
NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS
AASTKG
    Click to Show/Hide
Heavy Chain Constant Domain 1
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
    Click to Show/Hide
Heavy Chain Constant Domain 2
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
    Click to Show/Hide
Heavy Chain Constant Domain 3
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Hinge Region
EPKSCDKTHTCPPCP
    Click to Show/Hide
Heavy Chain CDR 1
GYTFTSYN
    Click to Show/Hide
Heavy Chain CDR 2
IYPGNGDT
    Click to Show/Hide
Heavy Chain CDR 3
ARSTYYGGDWYFNV
    Click to Show/Hide
Light Chain Sequence
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTV
    Click to Show/Hide
Light Chain Constant Domain
AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD
STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain CDR 1
SSVSY
    Click to Show/Hide
Light Chain CDR 2
ATS
    Click to Show/Hide
Light Chain CDR 3
QQWTSNPPT
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Aurixim [Phase 1]
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Inclusion: Adults (≥18y) with CD20+ indolent B-cell NHL (follicular, MALT, or marginal zone lymphoma), measurable lesions (>1.5cm), ECOG 0-2, adequate organ function, and contraception use. Exclusion: Prior MAb therapy (3 months), active infections, CNS involvement, severe cardiovascular/neuropathic conditions, HIV/HBV/HCV positivity, pregnancy, or uncontrolled comorbidities per investigator judgment.

   Click to Show/Hide
Administration Dosage
Dosage: 125 mg/m2, 250 mg/m2, 375 mg/m2 and 500 mg/m2. Formulation: concentrate for preparation of infusions 500 mg/50 ml and 100 mg/10 ml.Mode of administration: intravenous.
Related Clinical Trial
NCT Number NCT03057418  Clinical Status PHASE1
Clinical Description
Open-label Study of Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Aurixim Multiple Doses in Patients With Recurrent/Refractory B-cell, CD20-positive Non-Hodgkin Lymphoma of Low Tumor Grade or With Follicular Lymphoma
Primary Endpoint
The study evaluates treatment-emergent adverse events (AEs) and determines the maximum tolerated dose (MTD) of Aurixim over 24 weeks. Safety assessments include CTCAE-graded AEs, lab abnormalities, and ECG findings. MTD is defined as the highest dose where ≤1/6 patients experience dose-limiting toxicities (DLTs) within 36 days.
Other Endpoint
Pharmacokinetic (AUC, Cmax, T1/2) and pharmacodynamic (CD19+ levels) analyses will be conducted up to week 71 after single/multiple Aurixim doses to characterize drug exposure and biological effects.
Experiment 2 Reporting the Activity Date of This ADC [2]
Related Clinical Trial
NCT Number NCT03057418  Clinical Status Phase 1
Clinical Description
Open-label study of safety, tolerability, pharmacokinetics and pharmacodynamics of auriim multiple doses in patients with recurrent/refractory -cell, CD20-positive non-hodgkin lymphoma of low tumor grade or with follicular lymphoma.
Rituximab-Compound (la) DAR 8 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 0% Positive CD20 expression (CD20+++/++)
Method Description
Daudi human NHL fragments were implanted subcutaneously in theright flank of the mice. Mice were divided into 4 treatment groups (N=8/group), as follows: trastuzumab-Compound (la) conjugate (5 mg/kg, iv, qd x 1); rituximab-Compound (la) conjugate (1 mg/kg, iv, qd x 1).
In Vivo Model Daudi CDX model
In Vitro Model Burkitt lymphoma Daudi cells CVCL_0008
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 56.79% Positive CD20 expression (CD20+++/++)
Method Description
Daudi human NHL fragments were implanted subcutaneously in theright flank of the mice. Mice were divided into 4 treatment groups (N=8/group), as follows: trastuzumab-Compound (la) conjugate (5 mg/kg, iv, qd x 1); rituximab-Compound (la) conjugate (5 mg/kg, iv, qd x 1).
In Vivo Model Daudi CDX model
In Vitro Model Burkitt lymphoma Daudi cells CVCL_0008
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 84.72% High HER2 expression (HER2+++)
Method Description
BT474 human breast carcinomas fragments were implanted subcutaneously in theright flank of the mice. Mice were divided into 4 treatment groups (N=8/group), as follows: trastuzumab-Compound (la) conjugate (5 mg/kg, iv, qd x 1); rituximab-Compound (la) conjugate (5 mg/kg, iv, qd x 1); pertuzumab-Compound (la) conjugate (5 mg/kg, iv, qd x 1).
In Vivo Model BT-474 CDX model
In Vitro Model Invasive breast carcinoma BT-474 cells CVCL_0179
Revealed Based on the Cell Line Data
Click To Hide/Show 6 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.1 nM
Positive CD20 expression (CD20+++/++)
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Burkitt lymphoma Daudi cells CVCL_0008
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.44 nM
Positive CD20 expression (CD20+++/++)
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
5 nM
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Adult hepatocellular carcinoma SNU-182 cells CVCL_0090
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 100 nM
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Cystic fibrosis CFPAC-1 cells CVCL_1119
Experiment 5 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 100 nM
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Lung adenocarcinoma NCI-H2030 cells CVCL_1517
Experiment 6 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 100 nM
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Endometrial adenocarcinoma JHUEM-3 cells CVCL_4657
Rituximab-Compound (lc) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 50 pM Positive CD20 expression (CD20+++/++)
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Adult acute myeloid leukemia HL-60 cells CVCL_0002
CN109310885B ADC-7 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.26 nM
Positive CD20 expression (CD20+++/++)
Method Description
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.

   Click to Show/Hide
In Vitro Model Ovarian serous adenocarcinoma OVCAR-3 cells CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.83 nM
Positive CD20 expression (CD20+++/++)
Method Description
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma HCC4006 cells CVCL_1269
Experiment 3 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
2.76 nM
Positive CD20 expression (CD20+++/++)
Method Description
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.

   Click to Show/Hide
In Vitro Model Ovarian clear cell adenocarcinoma TOV-21G cells CVCL_3613
Experiment 4 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
53.04 nM
Positive CD20 expression (CD20+++/++)
Method Description
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.

   Click to Show/Hide
In Vitro Model Ovarian endometrioid adenocarcinoma IGROV-1 cells CVCL_1304
Rituximab-Compound (la) DAR 4 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.8 nM
Positive CD20 expression (CD20+++/++)
Method Description
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model Burkitt lymphoma Daudi cells CVCL_0008
CN109310885B ADC-8 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.13 nM
Positive CD20 expression (CD20+++/++)
Method Description
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.

   Click to Show/Hide
In Vitro Model Ovarian serous adenocarcinoma OVCAR-3 cells CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
5.29 nM
Positive CD20 expression (CD20+++/++)
Method Description
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma HCC4006 cells CVCL_1269
Experiment 3 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
37.3 nM
Positive CD20 expression (CD20+++/++)
Method Description
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.

   Click to Show/Hide
In Vitro Model Ovarian endometrioid adenocarcinoma IGROV-1 cells CVCL_1304
Experiment 4 Reporting the Activity Date of This ADC [4]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
39.68 nM
Positive CD20 expression (CD20+++/++)
Method Description
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.

   Click to Show/Hide
In Vitro Model Ovarian clear cell adenocarcinoma TOV-21G cells CVCL_3613
WO2017089890A1 ADC71 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [5]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.47 nM
Positive CD20 expression (CD20+++/++)
Method Description
Ramos cells, which are human Burkitt's lymphoma cells, were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 2 Reporting the Activity Date of This ADC [5]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 33.3 nM Negative CD20 expression (CD20-)
Method Description
Cells were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Chronic myeloid leukemia K562 cells CVCL_0004
WO2017089895A1 ADC71 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.47 nM
Positive CD20 expression (CD20+++/++)
Method Description
Ramos cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 2 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4 nM
Positive CD20 expression (CD20+++/++)
Method Description
ADCs wereincubated in human plasma for 5 seconds (0h), followed by SRB invitro cytotoxicity test using Ramos cells for 72hr.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 3 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4.13 nM
Positive CD20 expression (CD20+++/++)
Method Description
ADCs wereincubated in human plasma for 168 hours (168h), followed by SRB invitro cytotoxicity test using Ramos cells for 72hr.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 4 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 33.3 nM Negative CD20 expression (CD20-)
Method Description
K562 cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Chronic myeloid leukemia K562 cells CVCL_0004
WO2017089890A1 ADC72 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [5]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.78 nM
Positive CD20 expression (CD20+++/++)
Method Description
Ramos cells, which are human Burkitt's lymphoma cells, were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 2 Reporting the Activity Date of This ADC [5]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 33.3 nM Negative CD20 expression (CD20-)
Method Description
Cells were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Chronic myeloid leukemia K562 cells CVCL_0004
WO2017089895A1 ADC72 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
1.78 nM
Positive CD20 expression (CD20+++/++)
Method Description
Ramos cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 2 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
2 nM
Positive CD20 expression (CD20+++/++)
Method Description
ADCs wereincubated in human plasma for 5 seconds (0h), followed by SRB invitro cytotoxicity test using Ramos cells for 72hr.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 3 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
3.85 nM
Positive CD20 expression (CD20+++/++)
Method Description
ADCs wereincubated in human plasma for 168 hours (168h), followed by SRB invitro cytotoxicity test using Ramos cells for 72hr.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 4 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 33.3 nM Negative CD20 expression (CD20-)
Method Description
K562 cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Chronic myeloid leukemia K562 cells CVCL_0004
Rituximab-Compound (XVI) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [7]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 2 nM High HER2 expression (HER2+++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Invasive breast carcinoma BT-474 cells CVCL_0179
Rituximab-Compound (XLI) [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [7]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 2 nM High HER2 expression (HER2+++)
Method Description
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
In Vitro Model Invasive breast carcinoma BT-474 cells CVCL_0179
WO2017089890A1 ADC70 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [5]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4.56 nM
Positive CD20 expression (CD20+++/++)
Method Description
Ramos cells, which are human Burkitt's lymphoma cells, were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 2 Reporting the Activity Date of This ADC [5]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 33.3 nM Negative CD20 expression (CD20-)
Method Description
Cells were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Chronic myeloid leukemia K562 cells CVCL_0004
WO2017089895A1 ADC70 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
4.56 nM
Positive CD20 expression (CD20+++/++)
Method Description
Ramos cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Burkitt lymphoma Ramos cells CVCL_0597
Experiment 2 Reporting the Activity Date of This ADC [6]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 33.3 nM Negative CD20 expression (CD20-)
Method Description
K562 cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
In Vitro Model Chronic myeloid leukemia K562 cells CVCL_0004
WO2019126691A1 Conjugate No.62 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [8]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
1.37 nM
Positive HER2 expression (HER2+++/++)
Method Description
HT29 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model Colon cancer HT29 cells CVCL_A8EZ
Experiment 2 Reporting the Activity Date of This ADC [8]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
1.72 nM
Positive HER2 expression (HER2+++/++)
Method Description
DLD1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model Colon adenocarcinoma DLD1 cells CVCL_0248
WO2019126691A1 Conjugate No.94B [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [8]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
3.19 nM
Moderate HER2 expression (HER2++)
Method Description
JIMT1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model Breast ductal carcinoma JIMT1 cells CVCL_2077
References
Ref 1 Open-label Study of Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Aurixim
Ref 2 Open-label Study of Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Auriim Multiple Doses in Patients With Recurrent/Refractory -cell, CD20-positive Non-Hodgkin Lymphoma of Low Tumor Grade or With Follicular Lymphoma, NCT03057418
Ref 3 Neodegrader conjugates; 2021-10-07.
Ref 4 NaPi2b targeting antibody-drug conjugates and methods of use thereof.
Ref 5 Conjugates comprising self-immolative groups and methods related thereto.
Ref 6 Antibody-drug conjugates comprising branched linkers and methods related thereto; 2017-06-01.
Ref 7 Linkers for use in antibody drug conjugates; 2023-03-16.
Ref 8 Pyrrolobenzodiazepine antibody conjugates