Antibody Information
General Information of This Antibody
| Antibody ID | ANI0YRYTW |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Rituximab |
|||||
| Brand Name | MABTHERA; RITUXAN |
|||||
| Organization | Biogen, Inc. |
|||||
| Indication | Chronic lymphocytic leukemia; Rheumatoid arthritis; Non-Hodgkin's lymphoma; Pemphigus vulgaris |
|||||
| Approval Date | Nov. 1997 |
|||||
| Synonyms |
IDEC-C2B8; ABP798; ABP-798; BI695500; BI 695500; BI-695500; BLITZIMA; CT-P10; GP2013; HS006; HS-006; HS-006 (RITUXIMAB BIOSIMILAR); IDEC-102; IDEC-C2B8; MK-8808; PF-05280586; R-105 IDEC-102; RG-105; RHCACD20MA; RIABNI; RITEMVIA; RITUXIMAB ABBS; RITUXIMAB-ABBS; RITUXIMAB ARRX; RITUXIMAB-ARRX; RITUXIMAB BIOSIMILAR-CELLTRION; RITUXIMAB BIOSIMILAR-MERCK; RITUXIMAB-BOEHRINGER INGELHEIM; RITUXIMAB-CT-P10; RITUXIMAB (GENETICAL RECOMBINATION); RITUXIMAB-PFIZER; RITUXIMAB PVVR; RITUXIMAB-PVVR; RUXIENCE; SAIT101; SAIT-101; TRUXIMA; TUXELLA; USP MAB 001; MONOCLONAL IGG1 ZUBERITAMAB; MABTHERA; MABTHERA RITUXAN; Rituxan
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Chimeric IgG1-kappa |
|||||
| Antigen Name | B-lymphocyte antigen CD20 (MS4A1) |
Antigen Info | ||||
| ChEMBI ID | ||||||
| PDB ID | ||||||
| DrugBank ID | ||||||
| Drug Central ID | ||||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY
NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY
NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS AASTKG Click to Show/Hide
|
|||||
| Heavy Chain Constant Domain 1 |
PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV Click to Show/Hide
|
|||||
| Heavy Chain Constant Domain 2 |
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK Click to Show/Hide
|
|||||
| Heavy Chain Constant Domain 3 |
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain Hinge Region |
EPKSCDKTHTCPPCP
Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
GYTFTSYN
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
IYPGNGDT
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
ARSTYYGGDWYFNV
Click to Show/Hide
|
|||||
| Light Chain Sequence |
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTV Click to Show/Hide
|
|||||
| Light Chain Constant Domain |
AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD
STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
SSVSY
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
ATS
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
QQWTSNPPT
Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Aurixim [Phase 1]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT03057418 | Clinical Status | Phase 1 | ||
| Clinical Description |
Open-label study of safety, tolerability, pharmacokinetics and pharmacodynamics of auriim multiple doses in patients with recurrent/refractory -cell, CD20-positive non-hodgkin lymphoma of low tumor grade or with follicular lymphoma.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Inclusion: Adults (≥18y) with CD20+ indolent B-cell NHL (follicular, MALT, or marginal zone lymphoma), measurable lesions (>1.5cm), ECOG 0-2, adequate organ function, and contraception use. Exclusion: Prior MAb therapy (3 months), active infections, CNS involvement, severe cardiovascular/neuropathic conditions, HIV/HBV/HCV positivity, pregnancy, or uncontrolled comorbidities per investigator judgment.
Click to Show/Hide
|
||||
| Administration Dosage |
Dosage: 125 mg/m2, 250 mg/m2, 375 mg/m2 and 500 mg/m2. Formulation: concentrate for preparation of infusions 500 mg/50 ml and 100 mg/10 ml.Mode of administration: intravenous.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03057418 | Clinical Status | PHASE1 | ||
| Clinical Description |
Open-label Study of Safety, Tolerability, Pharmacokinetics and Pharmacodynamics of Aurixim Multiple Doses in Patients With Recurrent/Refractory B-cell, CD20-positive Non-Hodgkin Lymphoma of Low Tumor Grade or With Follicular Lymphoma
|
||||
| Primary Endpoint |
The study evaluates treatment-emergent adverse events (AEs) and determines the maximum tolerated dose (MTD) of Aurixim over 24 weeks. Safety assessments include CTCAE-graded AEs, lab abnormalities, and ECG findings. MTD is defined as the highest dose where ≤1/6 patients experience dose-limiting toxicities (DLTs) within 36 days.
|
||||
| Other Endpoint |
Pharmacokinetic (AUC, Cmax, T1/2) and pharmacodynamic (CD19+ levels) analyses will be conducted up to week 71 after single/multiple Aurixim doses to characterize drug exposure and biological effects.
|
||||
Rituximab-Compound (la) DAR 8 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 0% | Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Daudi human NHL fragments were implanted subcutaneously in theright flank of the mice. Mice were divided into 4 treatment groups (N=8/group), as follows: trastuzumab-Compound (la) conjugate (5 mg/kg, iv, qd x 1); rituximab-Compound (la) conjugate (1 mg/kg, iv, qd x 1).
|
||||
| In Vivo Model | Daudi CDX model | ||||
| In Vitro Model | Burkitt lymphoma | Daudi cells | CVCL_0008 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 56.79% | Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Daudi human NHL fragments were implanted subcutaneously in theright flank of the mice. Mice were divided into 4 treatment groups (N=8/group), as follows: trastuzumab-Compound (la) conjugate (5 mg/kg, iv, qd x 1); rituximab-Compound (la) conjugate (5 mg/kg, iv, qd x 1).
|
||||
| In Vivo Model | Daudi CDX model | ||||
| In Vitro Model | Burkitt lymphoma | Daudi cells | CVCL_0008 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 84.72% | High HER2 expression (HER2+++) | ||
| Method Description |
BT474 human breast carcinomas fragments were implanted subcutaneously in theright flank of the mice. Mice were divided into 4 treatment groups (N=8/group), as follows: trastuzumab-Compound (la) conjugate (5 mg/kg, iv, qd x 1); rituximab-Compound (la) conjugate (5 mg/kg, iv, qd x 1); pertuzumab-Compound (la) conjugate (5 mg/kg, iv, qd x 1).
|
||||
| In Vivo Model | BT-474 CDX model | ||||
| In Vitro Model | Invasive breast carcinoma | BT-474 cells | CVCL_0179 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.1 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Burkitt lymphoma | Daudi cells | CVCL_0008 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.44 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
5 nM
|
|||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Adult hepatocellular carcinoma | SNU-182 cells | CVCL_0090 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 100 nM | |||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Cystic fibrosis | CFPAC-1 cells | CVCL_1119 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 100 nM | |||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Lung adenocarcinoma | NCI-H2030 cells | CVCL_1517 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 100 nM | |||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Endometrial adenocarcinoma | JHUEM-3 cells | CVCL_4657 | ||
Rituximab-Compound (lc) [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 50 pM | Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Adult acute myeloid leukemia | HL-60 cells | CVCL_0002 | ||
CN109310885B ADC-7 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.26 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.83 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC4006 cells | CVCL_1269 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
2.76 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian clear cell adenocarcinoma | TOV-21G cells | CVCL_3613 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
53.04 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian endometrioid adenocarcinoma | IGROV-1 cells | CVCL_1304 | ||
Rituximab-Compound (la) DAR 4 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.8 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Burkitt lymphoma | Daudi cells | CVCL_0008 | ||
CN109310885B ADC-8 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.13 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
5.29 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC4006 cells | CVCL_1269 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
37.3 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian endometrioid adenocarcinoma | IGROV-1 cells | CVCL_1304 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
39.68 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian clear cell adenocarcinoma | TOV-21G cells | CVCL_3613 | ||
WO2017089890A1 ADC71 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.47 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Ramos cells, which are human Burkitt's lymphoma cells, were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 33.3 nM | Negative CD20 expression (CD20-) | ||
| Method Description |
Cells were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Chronic myeloid leukemia | K562 cells | CVCL_0004 | ||
WO2017089895A1 ADC71 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.47 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Ramos cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
4 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
ADCs wereincubated in human plasma for 5 seconds (0h), followed by SRB invitro cytotoxicity test using Ramos cells for 72hr.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
4.13 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
ADCs wereincubated in human plasma for 168 hours (168h), followed by SRB invitro cytotoxicity test using Ramos cells for 72hr.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 33.3 nM | Negative CD20 expression (CD20-) | ||
| Method Description |
K562 cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Chronic myeloid leukemia | K562 cells | CVCL_0004 | ||
WO2017089890A1 ADC72 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.78 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Ramos cells, which are human Burkitt's lymphoma cells, were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 33.3 nM | Negative CD20 expression (CD20-) | ||
| Method Description |
Cells were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Chronic myeloid leukemia | K562 cells | CVCL_0004 | ||
WO2017089895A1 ADC72 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.78 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Ramos cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
2 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
ADCs wereincubated in human plasma for 5 seconds (0h), followed by SRB invitro cytotoxicity test using Ramos cells for 72hr.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
3.85 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
ADCs wereincubated in human plasma for 168 hours (168h), followed by SRB invitro cytotoxicity test using Ramos cells for 72hr.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 33.3 nM | Negative CD20 expression (CD20-) | ||
| Method Description |
K562 cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Chronic myeloid leukemia | K562 cells | CVCL_0004 | ||
Rituximab-Compound (XVI) [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 2 nM | High HER2 expression (HER2+++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Invasive breast carcinoma | BT-474 cells | CVCL_0179 | ||
Rituximab-Compound (XLI) [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 2 nM | High HER2 expression (HER2+++) | ||
| Method Description |
The cells, at a predetermined concentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5% CO2, serial dilutions of each test article (TA) were added to the cells. Cells were incubated with test articles for 72 hours. and viability was detected with CellTiter-Gloreagent.
|
||||
| In Vitro Model | Invasive breast carcinoma | BT-474 cells | CVCL_0179 | ||
WO2017089890A1 ADC70 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
4.56 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Ramos cells, which are human Burkitt's lymphoma cells, were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 33.3 nM | Negative CD20 expression (CD20-) | ||
| Method Description |
Cells were seeded in a 96-well plate at 20,000 cells/well in 100 pL of growth media. The cells were incubated at 37°C in5% CO2, for 1 day. Serial dilutions of anti-CD19 ADCs were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Chronic myeloid leukemia | K562 cells | CVCL_0004 | ||
WO2017089895A1 ADC70 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
4.56 nM
|
Positive CD20 expression (CD20+++/++) | ||
| Method Description |
Ramos cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Burkitt lymphoma | Ramos cells | CVCL_0597 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 33.3 nM | Negative CD20 expression (CD20-) | ||
| Method Description |
K562 cells were seeded in a 96-wellplate at 20,000 cells/well in 100 uL of growth media. The cells were incubated at 37°C in5% CO, for 1 day. Serial dilutions of ADCs from 33.33 nM to 5.1 pM in 100 uL media were added to the wells, and the cells were incubated with the antibody & ADCs for 72 hours.
|
||||
| In Vitro Model | Chronic myeloid leukemia | K562 cells | CVCL_0004 | ||
WO2019126691A1 Conjugate No.62 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
1.37 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
HT29 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | Colon cancer | HT29 cells | CVCL_A8EZ | ||
| Experiment 2 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
1.72 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
DLD1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | Colon adenocarcinoma | DLD1 cells | CVCL_0248 | ||
WO2019126691A1 Conjugate No.94B [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
3.19 nM
|
Moderate HER2 expression (HER2++) | ||
| Method Description |
JIMT1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | Breast ductal carcinoma | JIMT1 cells | CVCL_2077 | ||
References
