General Information of This Antigen
Antigen ID
TAR0AABNG
Antigen Name
Sodium-dependent phosphate transport protein 2B (SLC34A2)
Gene Name
SLC34A2
Gene ID
10568
Synonym
Na(+)-dependent phosphate cotransporter 2B;NaPi3b;Sodium/phosphate cotransporter 2B;Solute carrier family 34 member 2
Sequence
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLI
DEPTEVDDPWNLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSS
AFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA
AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHY
LEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVK
IWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP
DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAI
LVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNA
LRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLI
PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSL
KPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVK
APETFDNITISREAQGEVPASDSKTECTAL

    Click to Show/Hide
Family
SEZ6 family
Function
Involved in actively transporting phosphate into cells via Na(+) cotransport.

    Click to Show/Hide
Uniprot Entry
NPT2B_HUMAN
HGNC ID
HGNC:11020
KEGG ID
hsa:10568
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
10H1.11.4B
ADC Info ADC Name Payload Target Linker Ref
CN109310885B ADC-10
CN109310885B ADC-10 payload
Undisclosed
CN109310885B ADC-10 linker
[1]
CN109310885B ADC-4
CN109310885B ADC-4 payload
Undisclosed
CN109310885B ADC-4 linker
[1]
CN109310885B ADC-5
CN109310885B ADC-5 payload
Undisclosed
CN109310885B ADC-5 linker
[1]
CN109310885B ADC-6
CN109310885B ADC-6 payload
Undisclosed
CN109310885B ADC-6 linker
[1]
CN109310885B ADC-9
CN109310885B ADC-9 payload
Undisclosed
CN109310885B ADC-9 linker
[1]
A humanized, Fc-silenced IgG1 antibody targeting Napi2b
ADC Info ADC Name Payload Target Linker Ref
TUB-040
Exatecan
DNA topoisomerase 1 (TOP1)
P5 (PEG24)-Val-Cit-PABC
[2]
An anti-NaPi2b humanized monoclonal antibody
ADC Info ADC Name Payload Target Linker Ref
YL-205
YL0010014
DNA topoisomerase 1 (TOP1)
Tumor microenviroment activable tripeptide linker
Anti-NaPi2b mAb 10H1.11.4B
ADC Info ADC Name Payload Target Linker Ref
NaPi2b PNU ADC3-1
NaPi2b PNU ADC3-1 payload
Undisclosed
NaPi2b PNU ADC3-1 linker
[3]
NaPi2b PNU ADC4-1
NaPi2b PNU ADC4-1 payload
Undisclosed
NaPi2b PNU ADC4-1 linker
[3]
NaPi2b-PNU-LD1
NaPi2b-PNU-LD1 payload
Undisclosed
NaPi2b-PNU-LD1 linker
[3]
NaPi2b-PNU-LD2
NaPi2b-PNU-LD2 payload
Undisclosed
NaPi2b-PNU-LD2 linker
[3]
NaPi2b-PNU-LD5
NaPi2b-PNU-LD5 payload
Undisclosed
NaPi2b-PNU-LD5 linker
[3]
NaPi2b-PNU-LD6
NaPi2b-PNU-LD6 payload
Undisclosed
NaPi2b-PNU-LD6 linker
[3]
NaPi2b-PNU-LD7
NaPi2b-PNU-LD7 payload
Undisclosed
NaPi2b-PNU-LD7 linker
[3]
Anti-NaPi2b-LC-K149C
ADC Info ADC Name Payload Target Linker Ref
Alpha-NaPi2b-LC-K149C-10
seco-CBI-dimer
Human Deoxyribonucleic acid (hDNA)
Mc-peptidomimetic based linker 10
[4]
Alpha-NaPi2b-LC-K149C-11
seco-CBI-dimer
Human Deoxyribonucleic acid (hDNA)
Mal-PEG2
[4]
CN105828840B_ADC-134 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-134
CN105828840B_ADC-134 payload
Undisclosed
CN105828840B_ADC-134 linker
[5]
CN105828840B_ADC-135 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-135
CN105828840B_ADC-135 payload
Undisclosed
CN105828840B_ADC-135 linker
[5]
CN105828840B_ADC-136 antibody
ADC Info ADC Name Payload Target Linker Ref
CN105828840B ADC-136
CN105828840B_ADC-136 payload
Undisclosed
CN105828840B_ADC-136 linker
[5]
Fully humanized Anti-SLC34A2 IgG1 mAb
ADC Info ADC Name Payload Target Linker Ref
ZW-220
ZD06519
DNA topoisomerase 1 (TOP1)
Mc-Gly-Gly-Phe-Gly-AM
[6]
Lifastuzumab
ADC Info ADC Name Payload Target Linker Ref
Lifastuzumab vedotin
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[7]
Thio Anti-Napi2B 10H1.11.4B LC V205C
ADC Info ADC Name Payload Target Linker Ref
WO2017214024A1 ADC-102
WO2017214024A1_ADC-102 payload
Undisclosed
WO2017214024A1_ADC-102 linker
[8]
Thio hu Anti-NaPi2b 10H1.11.4B LC K149C
ADC Info ADC Name Payload Target Linker Ref
WO2017059289A1 ADC-208
WO2017059289A1_ADC-208 payload
Undisclosed
WO2017059289A1_ADC-208 linker
[9]
Thio hu Anti-Napi3b 10H1.11.4B HC A118C
ADC Info ADC Name Payload Target Linker Ref
WO2014159981A2 ADC-205
WO2014159981A2_ADC-205 payload
Undisclosed
WO2014159981A2_ADC-205 linker
[10]
WO2014159981A2 ADC-SLC34A2-33
WO2014159981A2_ADC-SLC34A2-33 payload
Undisclosed
WO2014159981A2_ADC-SLC34A2-33 linker
[10]
WO2014159981A2 ADC-SLC34A2-37
WO2014159981A2_ADC-SLC34A2-37 payload
Undisclosed
WO2014159981A2_ADC-SLC34A2-37 linker
[10]
ADC Info ADC Name Payload Target Linker Ref
Upifitamab rilsodotin
Auristatin F hydroxypropylamide (AF-HPA)
Microtubule (MT)
Dolaflexin polymer
[11]
CN109310885B ADC-1
CN109310885B ADC-1 payload
Undisclosed
CN109310885B ADC-1 linker
[1]
CN109310885B ADC-2
CN109310885B ADC-2 payload
Undisclosed
CN109310885B ADC-2 linker
[1]
CN109310885B ADC-3
CN109310885B ADC-3 payload
Undisclosed
CN109310885B ADC-3 linker
[1]
WO2018098269A2 conjugate 53A
WO2018098269A2_conjugate 53A payload
Undisclosed
WO2018098269A2_conjugate 53A linker
[12]
WO2018098269A2 conjugate 53B
WO2018098269A2_conjugate 53B payload
Undisclosed
WO2018098269A2_conjugate 53B linker
[12]
WO2018098269A2 conjugate 53C
WO2018098269A2_conjugate 53C payload
Undisclosed
WO2018098269A2_conjugate 53C linker
[12]
WO2018098269A2 conjugate 53D
WO2018098269A2_conjugate 53D payload
Undisclosed
WO2018098269A2_conjugate 53D linker
[12]
WO2018098269A2 conjugate 53E
WO2018098269A2_conjugate 53E payload
Undisclosed
WO2018098269A2_conjugate 53E linker
[12]
WO2018098269A2 conjugate 55A
WO2018098269A2_conjugate 55A payload
Undisclosed
WO2018098269A2_conjugate 55A linker
[12]
WO2018098269A2 conjugate 55B
WO2018098269A2_conjugate 55B payload
Undisclosed
WO2018098269A2_conjugate 55B linker
[12]
WO2018098269A2 conjugate 57
WO2018098269A2_conjugate 57 payload
Undisclosed
WO2018098269A2_conjugate 57 linker
[12]
WO2018098269A2 conjugate 59
WO2018098269A2_conjugate 59 payload
Undisclosed
WO2018098269A2_conjugate 59 linker
[12]
WO2018098269A2 conjugate 61
WO2018098269A2_conjugate 61 payload
Undisclosed
WO2018098269A2_conjugate 61 linker
[12]
WO2018098269A2 conjugate 66
WO2018098269A2_conjugate 66 payload
Undisclosed
WO2018098269A2_conjugate 66 linker
[12]
WO2018098269A2 conjugate 76
WO2018098269A2_conjugate 76 payload
Undisclosed
WO2018098269A2_conjugate 76 linker
[12]
WO2018098269A2 conjugate 78
WO2018098269A2_conjugate 78 payload
Undisclosed
WO2018098269A2_conjugate 78 linker
[12]
WO2018098269A2 conjugate 79A
WO2018098269A2_conjugate 79A payload
Undisclosed
WO2018098269A2_conjugate 79A linker
[12]
WO2018098269A2 conjugate 79B
WO2018098269A2_conjugate 79B payload
Undisclosed
WO2018098269A2_conjugate 79B linker
[12]
WO2018098269A2 conjugate 83
WO2018098269A2_conjugate 83 payload
Undisclosed
WO2018098269A2_conjugate 83 linker
[12]
WO2018098269A2 conjugate 85
WO2018098269A2_conjugate 85 payload
Undisclosed
WO2018098269A2_conjugate 85 linker
[12]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
XMT-1592
Auristatin F hydroxypropylamide (AF-HPA)
Microtubule (MT)
Cys-13 ADC linker
[13]
Anti-NaPi3b antibody-drug conjugate (Genentech/Roche)
Monomethyl auristatin E
Microtubule (MT)
Undisclosed
[14]
BSI-715
Undisclosed
Undisclosed
Undisclosed
[15]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.330243367; Fold-change: 0.027363025; Z-score: 0.142733964
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.63902292; Fold-change: -0.027818332; Z-score: -1.383167705
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.45783172; Fold-change: -0.290701376; Z-score: -0.881628818
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.106223097; Fold-change: -0.176864527; Z-score: -1.047801379
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.14E-21; Fold-change: 0.112726927; Z-score: 0.53830518
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.32125349; Fold-change: 0.049701756; Z-score: 0.415642565
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.171630771; Fold-change: 0.098295308; Z-score: 0.836329149
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003863287; Fold-change: 0.095782899; Z-score: 0.864754115
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.864365639; Fold-change: -0.020206453; Z-score: -0.178659164
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.529151048; Fold-change: -0.055596927; Z-score: -0.22719282
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000109413; Fold-change: 0.25736855; Z-score: 5.270474676
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000415767; Fold-change: 0.074725411; Z-score: 0.332396516
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.725940372; Fold-change: -0.009996794; Z-score: -0.053014789
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.398221494; Fold-change: -0.023035204; Z-score: -0.108606194
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.999410244; Fold-change: 0.062215107; Z-score: 0.061169598
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000193983; Fold-change: 0.474328577; Z-score: 0.84694959
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.453302985; Fold-change: -0.038892415; Z-score: -0.155951832
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.64E-17; Fold-change: -0.320671701; Z-score: -1.058537622
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.423209734; Fold-change: 0.076603615; Z-score: 0.353820853
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.17E-60; Fold-change: -0.924680721; Z-score: -1.502679789
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.56E-39; Fold-change: -0.902191718; Z-score: -1.185418337
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.033324945; Fold-change: -0.561260565; Z-score: -0.533247995
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004884084; Fold-change: -0.032944816; Z-score: -0.193451934
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.539306635; Fold-change: -0.076315793; Z-score: -0.675496842
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.73E-23; Fold-change: -0.911463459; Z-score: -1.071539413
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 9.16E-05; Fold-change: -0.758627639; Z-score: -0.731351566
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000252513; Fold-change: 3.585892004; Z-score: 2.614444631
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.89E-05; Fold-change: 3.079569612; Z-score: 1.820907085
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.984146868; Fold-change: 0.14386004; Z-score: 0.104713653
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.87E-09; Fold-change: -1.262990765; Z-score: -0.767880818
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.41E-18; Fold-change: 2.820195819; Z-score: 15.62792951
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.164638748; Fold-change: -0.383940288; Z-score: -0.334867609
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000183668; Fold-change: 0.515590765; Z-score: 2.260742679
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.890950718; Fold-change: 0.003433614; Z-score: 0.046074748
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.55E-53; Fold-change: 3.500705941; Z-score: 5.430210429
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.34E-13; Fold-change: 3.207566416; Z-score: 2.440300657
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.129064182; Fold-change: 0.002357132; Z-score: 0.033671192
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.47E-12; Fold-change: -0.673135038; Z-score: -0.397962606
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.163208845; Fold-change: -0.260100331; Z-score: -0.19260112
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.129943865; Fold-change: -0.094404486; Z-score: -0.082634588
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.713800112; Fold-change: -0.137757287; Z-score: -1.480584459
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.257642731; Fold-change: -0.023272831; Z-score: -0.076692965
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.681003779; Fold-change: -0.008771579; Z-score: -0.076531085
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.940319193; Fold-change: 0.062309563; Z-score: 0.541784796
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.43531226; Fold-change: 0.016995859; Z-score: 0.150869536
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.691026172; Fold-change: 0.00736888; Z-score: 0.041041837
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.147768034; Fold-change: 0.155538066; Z-score: 0.769519502
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.546713009; Fold-change: 0.019557443; Z-score: 0.093811085
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000543151; Fold-change: 0.136541808; Z-score: 1.027661233
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.585101023; Fold-change: -0.014066242; Z-score: -0.113468598
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.189150662; Fold-change: -0.021177265; Z-score: -0.069607541
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.322770537; Fold-change: 0.209821606; Z-score: 1.240858436
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.621975674; Fold-change: 0.034759135; Z-score: 0.159008894
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.530925172; Fold-change: -0.033461766; Z-score: -0.24936729
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.888918556; Fold-change: -0.031287984; Z-score: -0.197265016
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.746793043; Fold-change: -0.049284112; Z-score: -0.486276874
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.216022927; Fold-change: -0.192291774; Z-score: -3.964162525
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.19569741; Fold-change: -0.007994312; Z-score: -0.018052366
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.440053924; Fold-change: -0.116658498; Z-score: -0.636107484
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.536997881; Fold-change: -0.010367892; Z-score: -0.064799635
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.890715996; Fold-change: -0.000637447; Z-score: -0.006055544
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.309724792; Fold-change: 0.036165268; Z-score: 0.043123516
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.918188955; Fold-change: -0.035321271; Z-score: -0.401037641
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.506646838; Fold-change: 0.04406933; Z-score: 0.183928145
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.599273155; Fold-change: -0.001049413; Z-score: -0.004971043
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.030677455; Fold-change: 2.303488973; Z-score: 4.581289432
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.033149838; Fold-change: -0.238960929; Z-score: -0.398235148
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.144621822; Fold-change: -0.219427711; Z-score: -0.307452269
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000210833; Fold-change: -2.210117466; Z-score: -1.037802983
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.861219023; Fold-change: -0.174022413; Z-score: -0.326437701
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.925005444; Fold-change: -0.13509276; Z-score: -0.197170975
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.20177116; Fold-change: 0.041910115; Z-score: 0.223946991
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.072050436; Fold-change: -0.129054293; Z-score: -1.091696673
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.37143275; Fold-change: 0.168654765; Z-score: 0.86079855
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.024342562; Fold-change: -0.220337439; Z-score: -0.874712498
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.558772868; Fold-change: 0.062669581; Z-score: 0.165448638
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.96E-06; Fold-change: 0.388959152; Z-score: 1.820083821
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011823318; Fold-change: -0.200934447; Z-score: -0.3592176
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.70E-12; Fold-change: -0.77253655; Z-score: -1.006485826
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.738826449; Fold-change: -0.225100449; Z-score: -0.221206389
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.418258918; Fold-change: 0.033435995; Z-score: 0.048695121
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013894185; Fold-change: -0.259216776; Z-score: -1.453290277
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.863098401; Fold-change: 0.037059857; Z-score: 0.188951726
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.339559782; Fold-change: -0.017438096; Z-score: -0.159863798
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.708280658; Fold-change: 0.023165878; Z-score: 0.057974481
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.407597597; Fold-change: -0.023504246; Z-score: -0.102365738
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.827812277; Fold-change: -0.046612062; Z-score: -0.330682849
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.177875026; Fold-change: 0.161499276; Z-score: 1.216284144
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.72545033; Fold-change: -0.051017223; Z-score: -0.023001698
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.764966004; Fold-change: 0.065664643; Z-score: 0.822685731
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.380558148; Fold-change: -0.336398065; Z-score: -0.564831807
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.085104095; Fold-change: -0.029756015; Z-score: -0.225340817
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013524309; Fold-change: -0.258665799; Z-score: -1.430998025
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.962660174; Fold-change: 0.024688879; Z-score: 0.172728306
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.113587185; Fold-change: -0.123329756; Z-score: -0.237261261
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.006810004; Fold-change: 0.093850137; Z-score: 0.275613083
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.943720474; Fold-change: -0.100884511; Z-score: -0.618432166
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.070030077; Fold-change: -0.134706609; Z-score: -0.920716279
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.168485451; Fold-change: 0.069280813; Z-score: 0.484870837
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.04E-21; Fold-change: -0.371667936; Z-score: -0.518473153
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.88E-40; Fold-change: -1.122091758; Z-score: -1.188455331
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.889119713; Fold-change: -0.075827592; Z-score: -0.073894361
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.304839718; Fold-change: -0.449521768; Z-score: -0.556830297
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.046641028; Fold-change: -0.089729537; Z-score: -0.882905683
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.108155668; Fold-change: -0.163142988; Z-score: -2.210241813
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008859299; Fold-change: 0.315261587; Z-score: 3.413161206
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.124361881; Fold-change: 0.117714973; Z-score: 0.585266007
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.017864122; Fold-change: 0.138803971; Z-score: 1.050797707
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.401227598; Fold-change: -0.001187209; Z-score: -0.010305973
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.75E-05; Fold-change: 0.172783418; Z-score: 2.202618971
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.033217254; Fold-change: 0.264835525; Z-score: 1.066773381
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.189246231; Fold-change: -0.54139692; Z-score: -0.988681741
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.499011595; Fold-change: 0.130761057; Z-score: 0.540827522
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.271044918; Fold-change: -0.034215769; Z-score: -0.280720832
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.985338043; Fold-change: 0.027138608; Z-score: 0.068541834
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.994727632; Fold-change: 0.003863907; Z-score: 0.024078567
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.369986944; Fold-change: -0.021599273; Z-score: -0.142398127
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.664191997; Fold-change: -0.10179519; Z-score: -0.448428519
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.664475252; Fold-change: -0.029882142; Z-score: -0.263606565
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.54855365; Fold-change: 0.020271053; Z-score: 0.134734756
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.354606516; Fold-change: -0.025081918; Z-score: -0.12463661
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.826246122; Fold-change: -0.014845302; Z-score: -0.168087436
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.291060792; Fold-change: 0.021272007; Z-score: 0.30931237
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.77566996; Fold-change: 0.010641982; Z-score: 0.075273997
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.036135887; Fold-change: -0.076033202; Z-score: -0.461082642
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.218924068; Fold-change: -0.004325345; Z-score: -0.071427062
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.849557623; Fold-change: -0.016419999; Z-score: -0.075375484
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.342463052; Fold-change: 0.060328394; Z-score: 0.4277928
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.085663535; Fold-change: 0.106447307; Z-score: 1.033366118
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 NaPi2b targeting antibody-drug conjugates and methods of use thereof.
Ref 2 https://tubulis.com/
Ref 3 Peptidomimetic compounds and antibody-drug conjugates thereof; 2015-09-03.
Ref 4 Antibody-Drug Conjugates Derived from Cytotoxic seco-CBI-Dimer Payloads Are Highly Efficacious in Xenograft Models and Form Protein Adducts In Vivo. Bioconjug Chem. 2019 May 15;30(5):1356-1370. doi: 10.1021/acs.bioconjchem.9b00133. Epub 2019 Apr 22.
Ref 5 1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment.
Ref 6 ZW220, a novel NaPi2b-targeting antibody drug conjugate bearing a topoisomerase 1 inhibitor payload. Cancer Res (2023) 83 (7_Supplement): 1533.
Ref 7 Phase Ia Study of Anti-NaPi2b Antibody-Drug Conjugate Lifastuzumab Vedotin DNIB0600A in Patients with Non-Small Cell Lung Cancer and Platinum-Resistant Ovarian Cancer. Clin Cancer Res. 2020 Jan 15;26(2):364-372.
Ref 8 Silvestrol antibody-drug conjugates and methods of use; 2017-12-14.
Ref 9 Pyrrolobenzodiazepine antibody drug conjugates and methods of use; 2017-04-06.
Ref 10 Pyrrolobenzodiazepines and conjugates thereof; 2015-04-09.
Ref 11 The Dolaflexin-based Antibody-Drug Conjugate XMT-1536 Targets the Solid Tumor Lineage Antigen SLC34A2/NaPi2b. Mol Cancer Ther. 2021 May;20(5):896-905.
Ref 12 Peptide-containing linkers for antibody-drug conjugates.
Ref 13 XMT-1592, a site-specific Dolasynthen-based NaPi2b-targeted antibody-drug conjugate for the treatment of ovarian cancer and lung adenocarcinoma. Cancer Res (2020) 80 (16_Supplement): 2894.
Ref 14 Anti-NaPi2b antibody-drug conjugate lifastuzumab vedotin (DNIB0600A) compared with pegylated liposomal doxorubicin in patients with platinum-resistant ovarian cancer in a randomized, open-label, phase II study. Ann Oncol. 2018 Apr 1;29(4):917-923.
Ref 15 Introduction to basic information on ADC drug BSI-715.