Antigen ID	TAR0AABNG
Antigen Name	Sodium-dependent phosphate transport protein 2B (SLC34A2)
Gene Name	SLC34A2
Gene ID	10568
Synonym	Na(+)-dependent phosphate cotransporter 2B;NaPi3b;Sodium/phosphate cotransporter 2B;Solute carrier family 34 member 2
Sequence	MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLI DEPTEVDDPWNLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSS AFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHY LEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVK IWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAI LVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNA LRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLI PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQSRCPRVLPKKLQNWNFLPLWMRSL KPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVK APETFDNITISREAQGEVPASDSKTECTAL     Click to Show/Hide
Family	SEZ6 family
Function	Involved in actively transporting phosphate into cells via Na(+) cotransport.     Click to Show/Hide
Uniprot Entry	NPT2B_HUMAN
HGNC ID	HGNC:11020
KEGG ID	hsa:10568

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN109310885B ADC-4	CN109310885B ADC-4 payload	Undisclosed	CN109310885B ADC-4 linker	[1]
ADC Info	CN109310885B ADC-5	CN109310885B ADC-5 payload	Undisclosed	CN109310885B ADC-5 linker	[1]
ADC Info	CN109310885B ADC-6	CN109310885B ADC-6 payload	Undisclosed	CN109310885B ADC-6 linker	[1]
ADC Info	CN109310885B ADC-9	CN109310885B ADC-9 payload	Undisclosed	CN109310885B ADC-9 linker	[1]
ADC Info	CN109310885B ADC-10	CN109310885B ADC-10 payload	Undisclosed	CN109310885B ADC-10 linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	NaPi2b PNU ADC3-1	NaPi2b PNU ADC3-1 payload	Undisclosed	NaPi2b PNU ADC3-1 linker	[2]
ADC Info	NaPi2b PNU ADC4-1	NaPi2b PNU ADC4-1 payload	Undisclosed	NaPi2b PNU ADC4-1 linker	[2]
ADC Info	NaPi2b-PNU-LD1	NaPi2b-PNU-LD1 payload	Undisclosed	NaPi2b-PNU-LD1 linker	[2]
ADC Info	NaPi2b-PNU-LD2	NaPi2b-PNU-LD2 payload	Undisclosed	NaPi2b-PNU-LD2 linker	[2]
ADC Info	NaPi2b-PNU-LD5	NaPi2b-PNU-LD5 payload	Undisclosed	NaPi2b-PNU-LD5 linker	[2]
ADC Info	NaPi2b-PNU-LD6	NaPi2b-PNU-LD6 payload	Undisclosed	NaPi2b-PNU-LD6 linker	[2]
ADC Info	NaPi2b-PNU-LD7	NaPi2b-PNU-LD7 payload	Undisclosed	NaPi2b-PNU-LD7 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Alpha-NaPi2b-LC-K149C-10	seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mc-peptidomimetic based linker 10	[3]
ADC Info	Alpha-NaPi2b-LC-K149C-11	seco-CBI-dimer	Human Deoxyribonucleic acid (hDNA)	Mal-PEG2	[3]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-134	CN105828840B_ADC-134 payload	Undisclosed	CN105828840B_ADC-134 linker	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-135	CN105828840B_ADC-135 payload	Undisclosed	CN105828840B_ADC-135 linker	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN105828840B ADC-136	CN105828840B_ADC-136 payload	Undisclosed	CN105828840B_ADC-136 linker	[4]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	ZW-220	ZD06519	DNA topoisomerase 1 (TOP1)	Mc-Gly-Gly-Phe-Gly-AM	[5]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Lifastuzumab vedotin	Monomethyl auristatin E	Microtubule (MT)	Mc-Val-Cit-PABC	[6]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2017214024A1 ADC-102	WO2017214024A1_ADC-102 payload	Undisclosed	WO2017214024A1_ADC-102 linker	[7]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2017059289A1 ADC-208	WO2017059289A1_ADC-208 payload	Undisclosed	WO2017059289A1_ADC-208 linker	[8]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	WO2014159981A2 ADC-205	WO2014159981A2_ADC-205 payload	Undisclosed	WO2014159981A2_ADC-205 linker	[9]
ADC Info	WO2014159981A2 ADC-SLC34A2-33	WO2014159981A2_ADC-SLC34A2-33 payload	Undisclosed	WO2014159981A2_ADC-SLC34A2-33 linker	[9]
ADC Info	WO2014159981A2 ADC-SLC34A2-37	WO2014159981A2_ADC-SLC34A2-37 payload	Undisclosed	WO2014159981A2_ADC-SLC34A2-37 linker	[9]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	Upifitamab rilsodotin	Auristatin F hydroxypropylamide (AF-HPA)	Microtubule (MT)	Dolaflexin polymer	[10]
ADC Info	WO2018098269A2 conjugate 53A	WO2018098269A2_conjugate 53A payload	Undisclosed	WO2018098269A2_conjugate 53A linker	[11]
ADC Info	WO2018098269A2 conjugate 55A	WO2018098269A2_conjugate 55A payload	Undisclosed	WO2018098269A2_conjugate 55A linker	[11]
ADC Info	WO2018098269A2 conjugate 57	WO2018098269A2_conjugate 57 payload	Undisclosed	WO2018098269A2_conjugate 57 linker	[11]
ADC Info	WO2018098269A2 conjugate 59	WO2018098269A2_conjugate 59 payload	Undisclosed	WO2018098269A2_conjugate 59 linker	[11]
ADC Info	WO2018098269A2 conjugate 61	WO2018098269A2_conjugate 61 payload	Undisclosed	WO2018098269A2_conjugate 61 linker	[11]
ADC Info	WO2018098269A2 conjugate 66	WO2018098269A2_conjugate 66 payload	Undisclosed	WO2018098269A2_conjugate 66 linker	[11]
ADC Info	WO2018098269A2 conjugate 79A	WO2018098269A2_conjugate 79A payload	Undisclosed	WO2018098269A2_conjugate 79A linker	[11]
ADC Info	WO2018098269A2 conjugate 76	WO2018098269A2_conjugate 76 payload	Undisclosed	WO2018098269A2_conjugate 76 linker	[11]
ADC Info	WO2018098269A2 conjugate 83	WO2018098269A2_conjugate 83 payload	Undisclosed	WO2018098269A2_conjugate 83 linker	[11]
ADC Info	WO2018098269A2 conjugate 78	WO2018098269A2_conjugate 78 payload	Undisclosed	WO2018098269A2_conjugate 78 linker	[11]
ADC Info	WO2018098269A2 conjugate 85	WO2018098269A2_conjugate 85 payload	Undisclosed	WO2018098269A2_conjugate 85 linker	[11]
ADC Info	WO2018098269A2 conjugate 53B	WO2018098269A2_conjugate 53B payload	Undisclosed	WO2018098269A2_conjugate 53B linker	[11]
ADC Info	WO2018098269A2 conjugate 53C	WO2018098269A2_conjugate 53C payload	Undisclosed	WO2018098269A2_conjugate 53C linker	[11]
ADC Info	WO2018098269A2 conjugate 53D	WO2018098269A2_conjugate 53D payload	Undisclosed	WO2018098269A2_conjugate 53D linker	[11]
ADC Info	WO2018098269A2 conjugate 53E	WO2018098269A2_conjugate 53E payload	Undisclosed	WO2018098269A2_conjugate 53E linker	[11]
ADC Info	WO2018098269A2 conjugate 55B	WO2018098269A2_conjugate 55B payload	Undisclosed	WO2018098269A2_conjugate 55B linker	[11]
ADC Info	WO2018098269A2 conjugate 79B	WO2018098269A2_conjugate 79B payload	Undisclosed	WO2018098269A2_conjugate 79B linker	[11]
ADC Info	CN109310885B ADC-1	CN109310885B ADC-1 payload	Undisclosed	CN109310885B ADC-1 linker	[1]
ADC Info	CN109310885B ADC-2	CN109310885B ADC-2 payload	Undisclosed	CN109310885B ADC-2 linker	[1]
ADC Info	CN109310885B ADC-3	CN109310885B ADC-3 payload	Undisclosed	CN109310885B ADC-3 linker	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	XMT-1592	Auristatin F hydroxypropylamide (AF-HPA)	Microtubule (MT)	Cys-13 ADC linker	[12]
ADC Info	BSI-715	Undisclosed	Undisclosed	Undisclosed	[13]
ADC Info	Anti-NaPi3b antibody-drug conjugate (Genentech/Roche)	Monomethyl auristatin E	Microtubule (MT)	Undisclosed	[14]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.330243367; Fold-change: 0.027363025; Z-score: 0.142733964
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.63902292; Fold-change: -0.027818332; Z-score: -1.383167705
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.45783172; Fold-change: -0.290701376; Z-score: -0.881628818
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.106223097; Fold-change: -0.176864527; Z-score: -1.047801379
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.14E-21; Fold-change: 0.112726927; Z-score: 0.53830518
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.32125349; Fold-change: 0.049701756; Z-score: 0.415642565
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.171630771; Fold-change: 0.098295308; Z-score: 0.836329149
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003863287; Fold-change: 0.095782899; Z-score: 0.864754115
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.864365639; Fold-change: -0.020206453; Z-score: -0.178659164
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.529151048; Fold-change: -0.055596927; Z-score: -0.22719282
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000109413; Fold-change: 0.25736855; Z-score: 5.270474676
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000415767; Fold-change: 0.074725411; Z-score: 0.332396516
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.725940372; Fold-change: -0.009996794; Z-score: -0.053014789
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.398221494; Fold-change: -0.023035204; Z-score: -0.108606194
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.999410244; Fold-change: 0.062215107; Z-score: 0.061169598
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000193983; Fold-change: 0.474328577; Z-score: 0.84694959
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.453302985; Fold-change: -0.038892415; Z-score: -0.155951832
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.64E-17; Fold-change: -0.320671701; Z-score: -1.058537622
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.423209734; Fold-change: 0.076603615; Z-score: 0.353820853
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.17E-60; Fold-change: -0.924680721; Z-score: -1.502679789
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.56E-39; Fold-change: -0.902191718; Z-score: -1.185418337
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.033324945; Fold-change: -0.561260565; Z-score: -0.533247995
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004884084; Fold-change: -0.032944816; Z-score: -0.193451934
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.539306635; Fold-change: -0.076315793; Z-score: -0.675496842
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.73E-23; Fold-change: -0.911463459; Z-score: -1.071539413
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.16E-05; Fold-change: -0.758627639; Z-score: -0.731351566
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000252513; Fold-change: 3.585892004; Z-score: 2.614444631
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.89E-05; Fold-change: 3.079569612; Z-score: 1.820907085
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.984146868; Fold-change: 0.14386004; Z-score: 0.104713653
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.87E-09; Fold-change: -1.262990765; Z-score: -0.767880818
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.41E-18; Fold-change: 2.820195819; Z-score: 15.62792951
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.164638748; Fold-change: -0.383940288; Z-score: -0.334867609
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000183668; Fold-change: 0.515590765; Z-score: 2.260742679
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.890950718; Fold-change: 0.003433614; Z-score: 0.046074748
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.55E-53; Fold-change: 3.500705941; Z-score: 5.430210429
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 7.34E-13; Fold-change: 3.207566416; Z-score: 2.440300657
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.129064182; Fold-change: 0.002357132; Z-score: 0.033671192
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.47E-12; Fold-change: -0.673135038; Z-score: -0.397962606
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.163208845; Fold-change: -0.260100331; Z-score: -0.19260112
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.129943865; Fold-change: -0.094404486; Z-score: -0.082634588
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.713800112; Fold-change: -0.137757287; Z-score: -1.480584459
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.257642731; Fold-change: -0.023272831; Z-score: -0.076692965
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.681003779; Fold-change: -0.008771579; Z-score: -0.076531085
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.940319193; Fold-change: 0.062309563; Z-score: 0.541784796
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.43531226; Fold-change: 0.016995859; Z-score: 0.150869536
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.691026172; Fold-change: 0.00736888; Z-score: 0.041041837
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.147768034; Fold-change: 0.155538066; Z-score: 0.769519502
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.546713009; Fold-change: 0.019557443; Z-score: 0.093811085
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000543151; Fold-change: 0.136541808; Z-score: 1.027661233
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.585101023; Fold-change: -0.014066242; Z-score: -0.113468598
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.189150662; Fold-change: -0.021177265; Z-score: -0.069607541
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.322770537; Fold-change: 0.209821606; Z-score: 1.240858436
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.621975674; Fold-change: 0.034759135; Z-score: 0.159008894
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.530925172; Fold-change: -0.033461766; Z-score: -0.24936729
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.888918556; Fold-change: -0.031287984; Z-score: -0.197265016
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.746793043; Fold-change: -0.049284112; Z-score: -0.486276874
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.216022927; Fold-change: -0.192291774; Z-score: -3.964162525
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.19569741; Fold-change: -0.007994312; Z-score: -0.018052366
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.440053924; Fold-change: -0.116658498; Z-score: -0.636107484
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.536997881; Fold-change: -0.010367892; Z-score: -0.064799635
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.890715996; Fold-change: -0.000637447; Z-score: -0.006055544
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.309724792; Fold-change: 0.036165268; Z-score: 0.043123516
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.918188955; Fold-change: -0.035321271; Z-score: -0.401037641
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.506646838; Fold-change: 0.04406933; Z-score: 0.183928145
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.599273155; Fold-change: -0.001049413; Z-score: -0.004971043
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.030677455; Fold-change: 2.303488973; Z-score: 4.581289432
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.033149838; Fold-change: -0.238960929; Z-score: -0.398235148
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.144621822; Fold-change: -0.219427711; Z-score: -0.307452269
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000210833; Fold-change: -2.210117466; Z-score: -1.037802983
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.861219023; Fold-change: -0.174022413; Z-score: -0.326437701
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.925005444; Fold-change: -0.13509276; Z-score: -0.197170975
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.20177116; Fold-change: 0.041910115; Z-score: 0.223946991
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.072050436; Fold-change: -0.129054293; Z-score: -1.091696673
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.37143275; Fold-change: 0.168654765; Z-score: 0.86079855
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.024342562; Fold-change: -0.220337439; Z-score: -0.874712498
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.558772868; Fold-change: 0.062669581; Z-score: 0.165448638
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.96E-06; Fold-change: 0.388959152; Z-score: 1.820083821
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.011823318; Fold-change: -0.200934447; Z-score: -0.3592176
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.70E-12; Fold-change: -0.77253655; Z-score: -1.006485826
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.738826449; Fold-change: -0.225100449; Z-score: -0.221206389
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.418258918; Fold-change: 0.033435995; Z-score: 0.048695121
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013894185; Fold-change: -0.259216776; Z-score: -1.453290277
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.863098401; Fold-change: 0.037059857; Z-score: 0.188951726
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.339559782; Fold-change: -0.017438096; Z-score: -0.159863798
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.708280658; Fold-change: 0.023165878; Z-score: 0.057974481
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.407597597; Fold-change: -0.023504246; Z-score: -0.102365738
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.827812277; Fold-change: -0.046612062; Z-score: -0.330682849
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.177875026; Fold-change: 0.161499276; Z-score: 1.216284144
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.72545033; Fold-change: -0.051017223; Z-score: -0.023001698
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.764966004; Fold-change: 0.065664643; Z-score: 0.822685731
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.380558148; Fold-change: -0.336398065; Z-score: -0.564831807
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.085104095; Fold-change: -0.029756015; Z-score: -0.225340817
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.013524309; Fold-change: -0.258665799; Z-score: -1.430998025
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.962660174; Fold-change: 0.024688879; Z-score: 0.172728306
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.113587185; Fold-change: -0.123329756; Z-score: -0.237261261
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.006810004; Fold-change: 0.093850137; Z-score: 0.275613083
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.943720474; Fold-change: -0.100884511; Z-score: -0.618432166
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.070030077; Fold-change: -0.134706609; Z-score: -0.920716279
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.168485451; Fold-change: 0.069280813; Z-score: 0.484870837
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.04E-21; Fold-change: -0.371667936; Z-score: -0.518473153
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 3.88E-40; Fold-change: -1.122091758; Z-score: -1.188455331
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.889119713; Fold-change: -0.075827592; Z-score: -0.073894361
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.304839718; Fold-change: -0.449521768; Z-score: -0.556830297
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.046641028; Fold-change: -0.089729537; Z-score: -0.882905683
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.108155668; Fold-change: -0.163142988; Z-score: -2.210241813
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008859299; Fold-change: 0.315261587; Z-score: 3.413161206
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.124361881; Fold-change: 0.117714973; Z-score: 0.585266007
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.017864122; Fold-change: 0.138803971; Z-score: 1.050797707
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.401227598; Fold-change: -0.001187209; Z-score: -0.010305973
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.75E-05; Fold-change: 0.172783418; Z-score: 2.202618971
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.033217254; Fold-change: 0.264835525; Z-score: 1.066773381
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.189246231; Fold-change: -0.54139692; Z-score: -0.988681741
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.499011595; Fold-change: 0.130761057; Z-score: 0.540827522
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.271044918; Fold-change: -0.034215769; Z-score: -0.280720832
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.985338043; Fold-change: 0.027138608; Z-score: 0.068541834
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.994727632; Fold-change: 0.003863907; Z-score: 0.024078567
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.369986944; Fold-change: -0.021599273; Z-score: -0.142398127
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.664191997; Fold-change: -0.10179519; Z-score: -0.448428519
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.664475252; Fold-change: -0.029882142; Z-score: -0.263606565
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.54855365; Fold-change: 0.020271053; Z-score: 0.134734756
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.354606516; Fold-change: -0.025081918; Z-score: -0.12463661
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.826246122; Fold-change: -0.014845302; Z-score: -0.168087436
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.291060792; Fold-change: 0.021272007; Z-score: 0.30931237
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.77566996; Fold-change: 0.010641982; Z-score: 0.075273997
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.036135887; Fold-change: -0.076033202; Z-score: -0.461082642
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.218924068; Fold-change: -0.004325345; Z-score: -0.071427062
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.849557623; Fold-change: -0.016419999; Z-score: -0.075375484
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.342463052; Fold-change: 0.060328394; Z-score: 0.4277928
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.085663535; Fold-change: 0.106447307; Z-score: 1.033366118
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	NaPi2b targeting antibody-drug conjugates and methods of use thereof.
Ref 2	Peptidomimetic compounds and antibody-drug conjugates thereof; 2015-09-03.
Ref 3	Antibody-Drug Conjugates Derived from Cytotoxic seco-CBI-Dimer Payloads Are Highly Efficacious in Xenograft Models and Form Protein Adducts In Vivo. Bioconjug Chem. 2019 May 15;30(5):1356-1370. doi: 10.1021/acs.bioconjchem.9b00133. Epub 2019 Apr 22.
Ref 4	1-(chloromethyl)-2,3-dihydro-1h-benzo[e]indole dimer antibody-drug conjugate compounds, and methods of use and treatment.
Ref 5	ZW220, a novel NaPi2b-targeting antibody drug conjugate bearing a topoisomerase 1 inhibitor payload. Cancer Res (2023) 83 (7_Supplement): 1533.
Ref 6	Phase Ia Study of Anti-NaPi2b Antibody-Drug Conjugate Lifastuzumab Vedotin DNIB0600A in Patients with Non-Small Cell Lung Cancer and Platinum-Resistant Ovarian Cancer. Clin Cancer Res. 2020 Jan 15;26(2):364-372.
Ref 7	Silvestrol antibody-drug conjugates and methods of use; 2017-12-14.
Ref 8	Pyrrolobenzodiazepine antibody drug conjugates and methods of use; 2017-04-06.
Ref 9	Pyrrolobenzodiazepines and conjugates thereof; 2015-04-09.
Ref 10	The Dolaflexin-based Antibody-Drug Conjugate XMT-1536 Targets the Solid Tumor Lineage Antigen SLC34A2/NaPi2b. Mol Cancer Ther. 2021 May;20(5):896-905.
Ref 11	Peptide-containing linkers for antibody-drug conjugates.
Ref 12	XMT-1592, a site-specific Dolasynthen-based NaPi2b-targeted antibody-drug conjugate for the treatment of ovarian cancer and lung adenocarcinoma. Cancer Res (2020) 80 (16_Supplement): 2894.
Ref 13	Introduction to basic information on ADC drug BSI-715.
Ref 14	Anti-NaPi2b antibody-drug conjugate lifastuzumab vedotin (DNIB0600A) compared with pegylated liposomal doxorubicin in patients with platinum-resistant ovarian cancer in a randomized, open-label, phase II study. Ann Oncol. 2018 Apr 1;29(4):917-923.