Antibody ID	ANI0TYNXL
Antibody Name	XMT-1535
Synonyms	Rebmab200; Upifitamab    Click to Show/Hide
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized IgG1-kappa
Antigen Name	Sodium-dependent phosphate transport protein 2B (SLC34A2)					Antigen Info
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	QVQLVQSGAEVVKPGASVKMSCKASGYTFTGYNIHWVKQAPGQGLEWIGAIYPGNGDTSY KQKFRGRATLTADTSTSTVYMELSSLRSEDSAVYYCARGETARATFAYWGQGTLVTVSSG ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG     Click to Show/Hide
Light Chain Sequence	DIQMTQSPSSLSASVGDRVTITCSASQDIGNFLNWYQQKPGKTVKVLIYYTSSLYSGVPS RFSGSGSGTDYTLTISSLQPEDFATYYCQQYSKLPLTFGQGTKLELKRRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC     Click to Show/Hide

Antibody Activity Information 1						[1]
Dissociation Constant (Kd)	0.73±0.34	nM
Antibody Function	Confirm the effect of the drug conjugation with the anti-NaPi2b Ab and ADC on binding activity to target.
Antibody Antigen Binding Assay	The optical density (OD) was measured at 450 nm with a SpectraMax M5 microplate reader. The Kd was calculated with GraphPad Prism software by nonlinear regression using the one site-specific binding model.XMT-1536 and the unconjugated antibody XMT-1535 bound to a peptide corresponding to the epitope of human NaPi2b.
Antibody Activity Information 2						[1]
Dissociation Constant (Kd)	4.05±2.62	nM	OVCAR-3 cells		CVCL_0465
Antigen Expression	Positive SLC34A2 expression (SLC34A2+++/++)
Antibody Function	Confirm the effect of the drug conjugation with the anti-NaPi2b Ab and ADC on binding activity to target.
Antibody Antigen Binding Assay	The median fluorescence value for each treatment was determined from 5,000 cells quantified on a MACSQuant flow cytometer. The Kd was calculated with GraphPad Prism software by nonlinear regression using the one site-specific binding model. Both XMT-1536 and the unconjugated XMT-1535 antibody bound to the NaPi2b-expressing OVCAR3 ovarian cancer cell line (~66000 NaPi2b antigens per cell) with nanomolar affinity.

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 42.53%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (1.5 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 99.72%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 45.70%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 51.69%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (1.5 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 98.84%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.02 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 54.09%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (1.5 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 98.71%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 99.72%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 77.51%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3.72 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 95.12%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 90.64%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 98.71%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.03 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 93.03%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.02 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 97.03%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.03 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 98.45%	Positive HER2 expression (HER2+++/++)
Method Description	Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
In Vivo Model	OVCAR-3 CDX model
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.05 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	2 pM	Positive SLC34A2 expression (SLC34A2+++/++)
Method Description	Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.    Click to Show/Hide
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.04 nM	Positive SLC34A2 expression (SLC34A2+++/++)
Method Description	Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.    Click to Show/Hide
In Vitro Model	Ovarian clear cell adenocarcinoma	TOV-21G cells		CVCL_3613
Experiment 3 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.13 nM	Positive SLC34A2 expression (SLC34A2+++/++)
Method Description	Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.    Click to Show/Hide
In Vitro Model	Lung adenocarcinoma	HCC4006 cells		CVCL_1269
Experiment 4 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	5 nM	Positive SLC34A2 expression (SLC34A2+++/++)
Method Description	Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.    Click to Show/Hide
In Vitro Model	Ovarian endometrioid adenocarcinoma	IGROV-1 cells		CVCL_1304

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.01 nM	Positive SLC34A2 expression (SLC34A2+++/++)
Method Description	Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.    Click to Show/Hide
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.35 nM	Positive SLC34A2 expression (SLC34A2+++/++)
Method Description	Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.    Click to Show/Hide
In Vitro Model	Lung adenocarcinoma	HCC4006 cells		CVCL_1269
Experiment 3 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.38 nM	Positive SLC34A2 expression (SLC34A2+++/++)
Method Description	Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.    Click to Show/Hide
In Vitro Model	Ovarian endometrioid adenocarcinoma	IGROV-1 cells		CVCL_1304
Experiment 4 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	6.68 nM	Positive SLC34A2 expression (SLC34A2+++/++)
Method Description	Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.    Click to Show/Hide
In Vitro Model	Ovarian clear cell adenocarcinoma	TOV-21G cells		CVCL_3613

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.01 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.01 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.01 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.02 nM	High HER2 expression (HER2+++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Breast adenocarcinoma	SK-BR-3 cells		CVCL_0033
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.09 nM	High HER2 expression (HER2+++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Invasive breast carcinoma	BT-474 cells		CVCL_0179
Experiment 4 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.1 nM	High HER2 expression (HER2+++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Gastric tubular adenocarcinoma	NCI-N87 cells		CVCL_1603
Experiment 5 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.14 nM	Negative HER2 expression (HER2-)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Invasive breast carcinoma	MCF-7 cells		CVCL_0031
Experiment 6 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	17.69 nM	Moderate HER2 expression (HER2++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Breast ductal carcinoma	JIMT-1 cells		CVCL_2077

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.02 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.03 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.03 nM	Positive HER2 expression (HER2+++/++)
Method Description	Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
In Vitro Model	Ovarian serous adenocarcinoma	OVCAR-3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.02 nM	Positive HER2 expression (HER2+++/++)
Method Description	OVCAR3 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model	High grade ovarian serous adenocarcinoma	OVCAR3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 100 nM	Moderate HER2 expression (HER2++)
Method Description	JIMT1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model	Breast ductal carcinoma	JIMT1 cells		CVCL_2077

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.05 nM	Positive HER2 expression (HER2+++/++)
Method Description	OVCAR3 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model	High grade ovarian serous adenocarcinoma	OVCAR3 cells		CVCL_0465

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.08 nM	Positive HER2 expression (HER2+++/++)
Method Description	OVCAR3 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model	High grade ovarian serous adenocarcinoma	OVCAR3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	20.5 nM	Moderate HER2 expression (HER2++)
Method Description	JIMT1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model	Breast ductal carcinoma	JIMT1 cells		CVCL_2077

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.16 nM	Positive HER2 expression (HER2+++/++)
Method Description	OVCAR3 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model	High grade ovarian serous adenocarcinoma	OVCAR3 cells		CVCL_0465
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	> 100 nM	Moderate HER2 expression (HER2++)
Method Description	JIMT1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
In Vitro Model	Breast ductal carcinoma	JIMT1 cells		CVCL_2077

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.01 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.01 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.01 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.015 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.015 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.02 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.03 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.03 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.03 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.03 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.05 nmol/L	Negative her2 expression (her2-)
Method Description	OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting    Click to Show/Hide
In Vitro Model	Ovarian carcinoma	OVCAR2 cells		CVCL_3941

Ref 1	Targeting Multiple EGFR-expressing Tumors with a Highly Potent Tumor-selective Antibody-Drug Conjugate. Mol Cancer Ther. 2020 Oct;19(10):2117-2125.
Ref 2	Peptide-containing linkers for antibody-drug conjugates.
Ref 3	NaPi2b targeting antibody-drug conjugates and methods of use thereof.
Ref 4	Pyrrolobenzodiazepine antibody conjugates
Ref 5	Peptide-containing linkers for antibody-drug conjugates