Antibody Information
General Information of This Antibody (ID: ANI0TYNXL)
| Antibody Name | XMT-1535 |
|||||
|---|---|---|---|---|---|---|
| Synonyms |
Rebmab200; Upifitamab
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Sodium-dependent phosphate transport protein 2B (SLC34A2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVVKPGASVKMSCKASGYTFTGYNIHWVKQAPGQGLEWIGAIYPGNGDTSY
KQKFRGRATLTADTSTSTVYMELSSLRSEDSAVYYCARGETARATFAYWGQGTLVTVSSG ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCSASQDIGNFLNWYQQKPGKTVKVLIYYTSSLYSGVPS
RFSGSGSGTDYTLTISSLQPEDFATYYCQQYSKLPLTFGQGTKLELKRRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
Dissociation Constant (Kd)
|
0.73±0.34
|
nM
|
||||
|---|---|---|---|---|---|---|
| Antibody Function | Confirm the effect of the drug conjugation with the anti-NaPi2b Ab and ADC on binding activity to target. | |||||
| Antibody Antigen Binding Assay | The optical density (OD) was measured at 450 nm with a SpectraMax M5 microplate reader. The Kd was calculated with GraphPad Prism software by nonlinear regression using the one site-specific binding model.XMT-1536 and the unconjugated antibody XMT-1535 bound to a peptide corresponding to the epitope of human NaPi2b. | |||||
| Antibody Activity Information 2 | [1] | |||||
|
Dissociation Constant (Kd)
|
4.05±2.62
|
nM
|
OVCAR-3 cells | CVCL_0465 | ||
| Antigen Expression | Positive SLC34A2 expression (SLC34A2+++/++) | |||||
| Antibody Function | Confirm the effect of the drug conjugation with the anti-NaPi2b Ab and ADC on binding activity to target. | |||||
| Antibody Antigen Binding Assay | The median fluorescence value for each treatment was determined from 5,000 cells quantified on a MACSQuant flow cytometer. The Kd was calculated with GraphPad Prism software by nonlinear regression using the one site-specific binding model. Both XMT-1536 and the unconjugated XMT-1535 antibody bound to the NaPi2b-expressing OVCAR3 ovarian cancer cell line (~66000 NaPi2b antigens per cell) with nanomolar affinity. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
WO2018098269A2 conjugate 76 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 42.53% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (1.5 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 99.72% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 61 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 45.70% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 78 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 51.69% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (1.5 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.84% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.02 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 57 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 54.09% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (1.5 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.71% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 99.72% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 59 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 77.51% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3.72 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95.12% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 55B [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 90.64% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.71% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.03 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 53D [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 93.03% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.02 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 66 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 97.03% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.03 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 55A [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.45% | Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Female CB-17 SCID mice were inoculated subcutaneously with OVCAR-3 cells (n=10 for each group). Mice inoculated subcutaneously with NCI-N87 cells (n=10 for each group) after IV administration as a single dose (3 mg/kg) on day 1.
|
||||
| In Vivo Model | OVCAR-3 CDX model | ||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.05 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
CN109310885B ADC-1 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
2 pM
|
Positive SLC34A2 expression (SLC34A2+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.04 nM
|
Positive SLC34A2 expression (SLC34A2+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian clear cell adenocarcinoma | TOV-21G cells | CVCL_3613 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.13 nM
|
Positive SLC34A2 expression (SLC34A2+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC4006 cells | CVCL_1269 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
5 nM
|
Positive SLC34A2 expression (SLC34A2+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian endometrioid adenocarcinoma | IGROV-1 cells | CVCL_1304 | ||
CN109310885B ADC-3 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.01 nM
|
Positive SLC34A2 expression (SLC34A2+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.35 nM
|
Positive SLC34A2 expression (SLC34A2+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC4006 cells | CVCL_1269 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.38 nM
|
Positive SLC34A2 expression (SLC34A2+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian endometrioid adenocarcinoma | IGROV-1 cells | CVCL_1304 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
6.68 nM
|
Positive SLC34A2 expression (SLC34A2+++/++) | ||
| Method Description |
Target expressing or non-expressing cells were seeded in 96-well cell culture plates for 24 hours before treatment. Cells were treated with 3-fold serially diluted antibody-drug conjugates or free compounds (i.e, no antibody conjugated to the drug) in duplicate at 10 concentrations. Cell viability was determined by CellTiter 96 AQueous One Solution Cell Proliferation MTS Assay.
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian clear cell adenocarcinoma | TOV-21G cells | CVCL_3613 | ||
WO2018098269A2 conjugate 53E [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.01 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 53B [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.01 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 53A [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.01 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.02 nM
|
High HER2 expression (HER2+++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Breast adenocarcinoma | SK-BR-3 cells | CVCL_0033 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.09 nM
|
High HER2 expression (HER2+++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Invasive breast carcinoma | BT-474 cells | CVCL_0179 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.1 nM
|
High HER2 expression (HER2+++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Gastric tubular adenocarcinoma | NCI-N87 cells | CVCL_1603 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.14 nM
|
Negative HER2 expression (HER2-) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
17.69 nM
|
Moderate HER2 expression (HER2++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Breast ductal carcinoma | JIMT-1 cells | CVCL_2077 | ||
WO2018098269A2 conjugate 79A [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.02 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 83 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.03 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2018098269A2 conjugate 53C [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.03 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
Cells were plated at a density of 5,000 cells per well in black walled 96-well plate and allowed to adhere overnight in a humidified at mosphere of 5% CO2. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measuredafter 10 min using a SpectraMax M5 plate reader.
|
||||
| In Vitro Model | Ovarian serous adenocarcinoma | OVCAR-3 cells | CVCL_0465 | ||
WO2019126691A1 Conjugate No.135 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.02 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
OVCAR3 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | High grade ovarian serous adenocarcinoma | OVCAR3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 100 nM | Moderate HER2 expression (HER2++) | ||
| Method Description |
JIMT1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | Breast ductal carcinoma | JIMT1 cells | CVCL_2077 | ||
WO2019126691A1 Conjugate No.73A [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.05 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
OVCAR3 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | High grade ovarian serous adenocarcinoma | OVCAR3 cells | CVCL_0465 | ||
WO2019126691A1 Conjugate No.94A [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.08 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
OVCAR3 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | High grade ovarian serous adenocarcinoma | OVCAR3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
20.5 nM
|
Moderate HER2 expression (HER2++) | ||
| Method Description |
JIMT1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | Breast ductal carcinoma | JIMT1 cells | CVCL_2077 | ||
WO2019126691A1 Conjugate No.136 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.16 nM
|
Positive HER2 expression (HER2+++/++) | ||
| Method Description |
OVCAR3 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | High grade ovarian serous adenocarcinoma | OVCAR3 cells | CVCL_0465 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 100 nM | Moderate HER2 expression (HER2++) | ||
| Method Description |
JIMT1 cells were plated at a density of 5000 cells per well and the next day were treated with antibody-PBD conjugate for 3 days.
|
||||
| In Vitro Model | Breast ductal carcinoma | JIMT1 cells | CVCL_2077 | ||
AU2017363246B2 Conjugate53A [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.01 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate53B [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.01 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate53E [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.01 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate78 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.015 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate79A [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.015 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate53D [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.02 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate66 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.03 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate53C [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.03 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate55C [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.03 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate83 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.03 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
AU2017363246B2 Conjugate55A [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.05 nmol/L
|
Negative her2 expression (her2-) | ||
| Method Description |
OVCAR3 cell line was plated at 5,000cell/well in black walled 96-well plate and allowed to adhere overnight. CellTiter-Glo reagent was added to the wells at room temperature and the luminescent signal was measured
after 10 min using a SpectraMax M5 plate reader (Molecular Devices). Dose response curves were generated using SoftMax Pro software. IC50 values were determined from four-parameter curve fitting
Click to Show/Hide
|
||||
| In Vitro Model | Ovarian carcinoma | OVCAR2 cells | CVCL_3941 | ||
References
