Antibody Information
General Information of This Antibody
| Antibody ID | ANI0IRYSG |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Anti-NaPi2b mAb 10H1.11.4B |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Sodium-dependent phosphate transport protein 2B (SLC34A2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFSFSDFAMSWVRQAPGKGLEWVATIGRVAFHTYY
PDSMKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHRGFDVGHFDFWGQGTLVTVSS CSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRSSETLVHSSGNTYLEWYQQKPGKAPKLLIYRVSNRF
SGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCFQGSFNPLTFGQGTKVEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
NaPi2b PNU ADC4-1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 8.52% (Day 14) | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
Single intravenous (IV) administration of ADCs to mice bearing HL-60 AML xenografts, each conjugate (in 0.8 mg/kg) that were administered once IV at the day 0 time point.
|
||||
| In Vivo Model | HL-60 CDX model | ||||
| In Vitro Model | Adult acute myeloid leukemia | HL-60 cells | CVCL_0002 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
218 ng/mL
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predeterminedconcentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5CO2, serialdilutions of each test article (TA) were added to the cells. Cells were incubated with test articlesfor 72 hours, and viability was detected with CellTiter-Glo reagent.
|
||||
| In Vitro Model | Chronic eosinophilic leukemia | EoL-1 cells | CVCL_0258 | ||
NaPi2b PNU ADC3-1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 23.73% (Day 15) | Positive CD33 expression (CD33+++/++) | ||
| Method Description |
Single intravenous (IV) administration of ADCs to mice bearing HL-60 AML xenografts, each conjugate (in 0.6 mg/kg) that were administered once IV at the day 0 time point.
|
||||
| In Vivo Model | HL-60 CDX model | ||||
| In Vitro Model | Adult acute myeloid leukemia | HL-60 cells | CVCL_0002 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
24.20 ng/mL
|
Positive CD33 expression (CD33+++/++) | ||
| Method Description |
The cells, at a predeterminedconcentration, were plated into 96 well plates, and, after overnight incubation at 37°C/5CO2, serialdilutions of each test article (TA) were added to the cells. Cells were incubated with test articlesfor 72 hours, and viability was detected with CellTiter-Glo reagent.
|
||||
| In Vitro Model | Chronic eosinophilic leukemia | EoL-1 cells | CVCL_0258 | ||
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.