Target Information

General Information of This Target

Target ID	PATR0CZQGR
Target Name	Toll-like receptor 7 (TLR7); Toll-like receptor 8 (TLR8)
Gene Name	TLR7; TLR8
Gene ID	51284 ; 51311
Synonym 2	CD_antigen=CD288
Sequence 1	MVFPMWTLKRQILILFNIILISKLLGARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIP GGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKP RSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKENLTELANIEILYLG QNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTAVPTVLPSTLTELYLYNNMIAKI QEDDFNNLNQLQILDLSGNCPRCYNAPFPCAPCKNNSPLQIPVNAFDALTELKVLRLHSN SLQHVPPRWFKNINKLQELDLSQNFLAKEIGDAKFLHFLPSLIQLDLSFNFELQVYRASM NLSQAFSSLKSLKILRIRGYVFKELKSFNLSPLHNLQNLEVLDLGTNFIKIANLSMFKQF KRLKVIDLSVNKISPSGDSSEVGFCSNARTSVESYEPQVLEQLHYFRYDKYARSCRFKNK EASFMSVNESCYKYGQTLDLSKNSIFFVKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQP LAELRYLDFSNNRLDLLHSTAFEELHKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQK LMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKN SLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKNLETLDLSHNQLTTVPERLSN CSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLL HHNRFLCTCDAVWFVWWVNHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCELDLTNL ILFSLSISVSLFLMVMMTASHLYFWDVWYIYHFCKAKIKGYQRLISPDCCYDAFIVYDTK DPAVTEWVLAELVAKLEDPREKHFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTDK YAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPFQKSKFLQLRKRLCGSSVLEWPTNPQ AHPYFWQCLKNALATDNHVAYSQVFKETV Click to Show/Hide
Sequence 2	MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQT VGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGA FLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWN CYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEE DFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR KINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINIS RNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNL EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCA AYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNN RLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT DKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFL NLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLS HNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDI GDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAF YLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRN VVLTENDSRYNNMYVDSIKQY Click to Show/Hide
Family	the Toll-like receptor family; the Toll-like receptor family
Function 1	Endosomal receptor that plays a key role in innate and adaptive immunity. Controls host immune response against pathogens through recognition of uridine- containing single strand RNAs (ssRNAs) of viral origin or guanosine analogs. Upon binding to agonists, undergoes dimerization that brings TIR domains from the two molecules into direct contact, leading to the recruitment of TIR-containing downstream adapter MYD88 through homotypic interaction. In turn, the Myddosome signaling complex is formed involving IRAK4, IRAK1, TRAF6, TRAF3 leading to activation of downstream transcription factors NF-kappa-B and IRF7 to induce pro-inflammatory cytokines and interferons, respectively. Click to Show/Hide
Function 2	Endosomal receptor that plays a key role in innate and adaptive immunity. Controls host immune response against pathogens through recognition of RNA degradation products specific to microorganisms that are initially processed by RNASET2. Recognizes GU-rich single- stranded RNA (GU-rich RNA) derived from SARS-CoV-2, SARS-CoV-1 and HIV- 1 viruses. Upon binding to agonists, undergoes dimerization that brings TIR domains from the two molecules into direct contact, leading to the recruitment of TIR-containing downstream adapter MYD88 through homotypic interaction. In turn, the Myddosome signaling complex is formed involving IRAK4, IRAK1, TRAF6, TRAF3 leading to activation of downstream transcription factors NF- kappa-B and IRF7 to induce pro-inflammatory cytokines and interferons, respectively. Click to Show/Hide
Uniprot Entry	TLR7_HUMAN ; TLR8_HUMAN
HGNC ID	HGNC:15631 ; HGNC:15632
KEGG ID	hsa:51284 ; hsa:51311

Full List of The ADC Related to This Target

Phase 1/2 (discontinued)

Click To Hide/Show 1 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	SBT6290	Anti-Nectin-4 antibody	nectin-4	TLR8 agonist	Undisclosed

Phase 1/2 (discontinued)

Click To Hide/Show 2 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	Pertuzumab zuvotolimod	Pertuzumab	HER2	Zuvotolimod	Mc-Val-Cit-PABC
ADC Info	GQ1007	Anti-HER2 antibody	HER2	TLR7/8 agonist	Stable linker

Phase 2 (discontinued)

Click To Hide/Show 4 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	Trastuzumab imbotolimod	Trastuzumab	HER2	T785	BG based linker	[1]
ADC Info	ADC HE-S2	Avelumab	Programmed cell death 1 ligand 1 (CD274)	Bifunctional immunomodulator D18	Disulfide linker 8	[2]
ADC Info	BDB-101	Undisclosed	Programmed cell death 1 ligand 1 (CD274)	TLR7/8 agonist	Undisclosed	[3]
ADC Info	PD-L1 ISA	Undisclosed	Programmed cell death 1 ligand 1 (CD274)	TLR7/8 agonist	Undisclosed	[4]

Investigative

Click To Hide/Show 37 ADC Related to This Stage

ADC Info	ADC Name	Antibody	Antigen	Payload	Linker	Ref
ADC Info	CD276 mAb-IMQ	Hu276 mAb	CD276 antigen (CD276)	imiquimod	Phosphine-azide	[5]
ADC Info	isumab01-C2a	Undisclosed	Folate receptor alpha (FRalpha)	WO2025015586A1, ADC25, Payload	Undisclosed	[6]
ADC Info	isumab01-C2b	Undisclosed	Folate receptor alpha (FRalpha)	WO2025015586A1, ADC25, Payload	Undisclosed	[6]
ADC Info	isumab01-C3	Undisclosed	Folate receptor alpha (FRalpha)	WO2025015586A1, ADC23, Payload	Undisclosed	[6]
ADC Info	isumab01-C6	Undisclosed	Folate receptor alpha (FRalpha)	WO2025015586A1, ADC24, Payload	Undisclosed	[6]
ADC Info	isumab04-C6	Undisclosed	Undisclosed	WO2025015586A1, ADC24, Payload	Undisclosed	[6]
ADC Info	isumab01-C7	Undisclosed	Folate receptor alpha (FRalpha)	WO2025015586A1, ADC34, Payload	Undisclosed	[6]
ADC Info	isumab01-C8	Undisclosed	Folate receptor alpha (FRalpha)	WO2025015586A1, ADC35, Payload	Undisclosed	[6]
ADC Info	wO2023232144A1ADC23	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC23, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC24	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC24, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC25	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC25, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC27	Avelumab	Programmed cell death 1 ligand 1 (CD274)	WO2025015586A1, ADC23, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC28	Avelumab	Programmed cell death 1 ligand 1 (CD274)	WO2025015586A1, ADC24, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC29	Avelumab	Programmed cell death 1 ligand 1 (CD274)	WO2025015586A1, ADC25, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC30	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC25, Payload	SMCC	[7]
ADC Info	wO2023232144A1ADC31	Avelumab	Programmed cell death 1 ligand 1 (CD274)	WO2025015586A1, ADC25, Payload	SMCC	[7]
ADC Info	wO2023232144A1ADC34	mouse anti-human HER2 Ab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC34, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC35	mouse anti-human HER2 Ab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC35, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC36	mouse anti-human HER2 Ab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC34, Payload	SMCC	[7]
ADC Info	wO2023232144A1ADC37	mouse anti-human HER2 Ab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC35, Payload	SMCC	[7]
ADC Info	wO2023232144A1ADC38	Anti-mouse PD-L1 (B7-H1)	Programmed cell death 1 ligand 1 (PD-L1)	WO2025015586A1, ADC34, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC39	Anti-mouse PD-L1 (B7-H1)	Programmed cell death 1 ligand 1 (PD-L1)	WO2025015586A1, ADC35, Payload	Mc-Val-Cit-PABC	[7]
ADC Info	wO2023232144A1ADC40	Anti-mouse PD-L1 (B7-H1)	Programmed cell death 1 ligand 1 (PD-L1)	WO2025015586A1, ADC34, Payload	SMCC	[7]
ADC Info	wO2023232144A1ADC41	Anti-mouse PD-L1 (B7-H1)	Programmed cell death 1 ligand 1 (PD-L1)	WO2025015586A1, ADC35, Payload	SMCC	[7]
ADC Info	wO2023232144A1ADC42	Avelumab	Programmed cell death 1 ligand 1 (CD274)	WO2025015586A1, ADC34, Payload	SMCC	[7]
ADC Info	wO2023232144A1ADC43	Avelumab	Programmed cell death 1 ligand 1 (CD274)	WO2025015586A1, ADC35, Payload	SMCC	[7]
ADC Info	wO2023232144A1ADC44	Atezolizumab	Programmed cell death 1 ligand 1 (CD274)	WO2025015586A1, ADC35, Payload	SMCC	[7]
ADC Info	uS20250025567A1 ExL1A1	anti-hCLDN6 antibody Ab1	Claudin-6 (CLDN6)	5-[ (4-{[ (2S)-2- (fluoromethyl)piperazin-1-yl]methyl}-2-methoxyphenyl)methyl\|]-N4-pentyl-5H-pyrrolo[3,2-d]pyrimidine-2,4-diamine	3-Maleimidopropionic acid linker	[8]
ADC Info	uS20250025567A1 ExL5A1	anti-hCLDN6 antibody Ab1	Claudin-6 (CLDN6)	US20250025567A1, ExlL5A1, Payload	Ethylmaleimide linker	[8]
ADC Info	uS20250025567A1 ExL7A1	anti-hCLDN6 antibody Ab1	Claudin-6 (CLDN6)	US20250025567A1, ExlL7A1, Payload	3-Maleimidopropionic acid linker	[8]
ADC Info	uS20250025567A1 ExL9A1	anti-hCLDN6 antibody Ab1	Claudin-6 (CLDN6)	US20250025567A1, ExlL7A1, Payload	3-Maleimidopropionic acid linker	[8]
ADC Info	cN113943310A ADC-11	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC25, Payload	Mc-Gly-Gly-Phe-Gly	[9]
ADC Info	cN113943310A ADC-12	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC25, Payload	CN113943310A, ADC-12, Linker	[9]
ADC Info	cN113943310A ADC-13	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC23, Payload	CN113943310A, ADC-12, Linker	[9]
ADC Info	cN113943310A ADC-16	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC24, Payload	CN113943310A, ADC-12, Linker	[9]
ADC Info	cN113943310A ADC-17	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC35, Payload	CN113943310A, ADC-12, Linker	[9]
ADC Info	cN113943310A ADC-18	Trastuzumab	Receptor tyrosine-protein kinase erbB-2 (ERBB2)	WO2025015586A1, ADC34, Payload	CN113943310A, ADC-12, Linker	[9]

References

Ref 1	Introduction to basic information on ADC drug trastuzumab imbotolimod.
Ref 2	Immune Modulating Antibody-Drug Conjugate (IM-ADC) for Cancer Immunotherapy. J Med Chem. 2021 Nov 11;64(21):15716-15726. doi: 10.1021/acs.jmedchem.1c00961. Epub 2021 Nov 3.
Ref 3	Seven and eight biopharmaceutical company produce pipeline
Ref 4	PD-L1-targeted ISAC combines myeloid cell activation, immune checkpoint inhibition and ADCP to improve anti-tumor efficacy over anti-PD-L1 antibodies in preclinical models; 2021
Ref 5	A Dual-Payload Antibody-Drug Conjugate Targeting CD276/B7-H3 Elicits Cytotoxicity and Immune Activation in Triple-Negative Breast Cancer
Ref 6	Antibody-drug conjugate compounds, and methods of use and treatment
Ref 7	Drug conjugates of imidazoquinoline amine derivatives, compositions and methods thereof
Ref 8	Antibody-drug complex containing Toll-like receptor 7/8 dual agonist compound
Ref 9	Deuterated camptothecin derivatives and their antibody-drug conjugates

Target Information

Citation

Visitor Map

Correspondence

Prof. Feng ZHU (zhufeng@zju.edu.cn)

Prof. Xiaowu DONG (dongxw@zju.edu.cn)

Prof. Luo FANG (fangluo@zjcc.org.cn)