General Information of This Antigen
Antigen ID
TAR0XGJXK
Antigen Name
Insulin-like growth factor 1 receptor (IGF1R)
Gene Name
IGF1R
Gene ID
3480
Synonym
Insulin-like growth factor I receptor;CD_antigen=CD221
Sequence
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
Y.IQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKR
NNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVV
KDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELM
TRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCM
VAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVL
WEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEI
ISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSG
HKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC

    Click to Show/Hide
Family
Tyr protein family
Function
Receptor tyrosine kinase which mediates actions of insulin- like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation, and tyrosines phosphorylation of multiple substrates, that function as signaling adapter proteins including, the insulin-receptor substrates (IRS1/2), Shc and 14-3-3 proteins. Phosphorylation of IRSs proteins lead to the activation of two main signaling pathways: the PI3K-AKT/PKB pathway and the Ras-MAPK pathway. The result of activating the MAPK pathway is increased cellular proliferation, whereas activating the PI3K pathway inhibits apoptosis and stimulates protein synthesis. Phosphorylated IRS1 can activate the 85 kDa regulatory subunit of PI3K (PIK3R1), leading to activation of several downstream substrates, including protein AKT/PKB. AKT phosphorylation, in turn, enhances protein synthesis through mTOR activation and triggers the antiapoptotic effects of IGFIR through phosphorylation and inactivation of BAD. In parallel to PI3K-driven signaling, recruitment of Grb2/SOS by phosphorylated IRS1 or Shc leads to recruitment of Ras and activation of the ras-MAPK pathway. In addition to these two main signaling pathways IGF1R signals also through the Janus kinase/signal transducer and activator of transcription pathway (JAK/STAT). Phosphorylation of JAK proteins can lead to phosphorylation/activation of signal transducers and activators of transcription (STAT) proteins. In particular activation of STAT3, may be essential for the transforming activity of IGF1R. The JAK/STAT pathway activates gene transcription and may be responsible for the transforming activity. JNK kinases can also be activated by the IGF1R. IGF1 exerts inhibiting activities on JNK activation via phosphorylation and inhibition of MAP3K5/ASK1, which is able to directly associate with the IGF1R.; When present in a hybrid receptor with INSR, binds IGF1. shows that hybrid receptors composed of IGF1R and INSR isoform Long are activated with a high affinity by IGF1, with low affinity by IGF2 and not significantly activated by insulin, and that hybrid receptors composed of IGF1R and INSR isoform Short are activated by IGF1, IGF2 and insulin. In contrast, shows that hybrid receptors composed of IGF1R and INSR isoform Long and hybrid receptors composed of IGF1R and INSR isoform Short have similar binding characteristics, both bind IGF1 and have a low affinity for insulin.

    Click to Show/Hide
Uniprot Entry
IGF1R_HUMAN
HGNC ID
HGNC:5465
KEGG ID
hsa:3480
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-IGF1R mAb
ADC Info ADC Name Payload Target Linker Ref
IGF-MTX
Methotrexate
Dihydrofolate reductase (DHFR)
Undisclosed
[1]
ADC Info ADC Name Payload Target Linker Ref
c208F2-E-11
c208F2-E-11 payload
Undisclosed
c208F2-E-11 linker
[2]
c208F2-E-12
c208F2-E-12 payload
Undisclosed
c208F2-E-12 linker
[2]
c208F2-G-12
c208F2-G-12 payload
Undisclosed
c208F2-G-12 linker
[2]
c208F2-E-13
c208F2-E-13 payload
Undisclosed
c208F2-E-13 linker
[2]
c208F2-F-13
c208F2-F-13 payload
Undisclosed
c208F2-F-13 linker
[2]
c208F2-G-13
c208F2-G-13 payload
Undisclosed
c208F2-G-13 linker
[2]
c208F2-E-15
c208F2-E-15 payload
Undisclosed
c208F2-E-15 linker
[2]
c208F2-G-15
c208F2-G-15 payload
Undisclosed
c208F2-G-15 linker
[2]
c208F2-F-61
c208F2-F-61 payload
Undisclosed
c208F2-F-61 linker
[2]
c208F2-F-62
c208F2-F-62 payload
Undisclosed
c208F2-F-62 linker
[2]
c208F2-F-63
c208F2-F-63 payload
Undisclosed
c208F2-F-63 linker
[2]
ADC Info ADC Name Payload Target Linker Ref
c212A11-E-11
c212A11-E-11 payload
Undisclosed
c212A11-E-11 linker
[2]
c212A11-E-12
c212A11-E-12 payload
Undisclosed
c212A11-E-12 linker
[2]
c212A11-G-12
c212A11-G-12 payload
Undisclosed
c212A11-G-12 linker
[2]
c212A11-E-13
c212A11-E-13 payload
Undisclosed
c212A11-E-13 linker
[2]
c212A11-F-13
c212A11-F-13 payload
Undisclosed
c212A11-F-13 linker
[2]
c212A11-G-13
c212A11-G-13 payload
Undisclosed
c212A11-G-13 linker
[2]
c212A11-E-15
c212A11-E-15 payload
Undisclosed
c212A11-E-15 linker
[2]
c212A11-G-15
c212A11-G-15 payload
Undisclosed
c212A11-G-15 linker
[2]
c212A11-F-61
c212A11-F-61 payload
Undisclosed
c212A11-F-61 linker
[2]
c212A11-F-62
c212A11-F-62 payload
Undisclosed
c212A11-F-62 linker
[2]
c212A11-F-63
c212A11-F-63 payload
Undisclosed
c212A11-F-63 linker
[2]
ADC Info ADC Name Payload Target Linker Ref
c213B10-E-11
c213B10-E-11 payload
Undisclosed
c213B10-E-11 linker
[2]
c213B10-E-12
c213B10-E-12 payload
Undisclosed
c213B10-E-12 linker
[2]
c213B10-G-12
c213B10-G-12 payload
Undisclosed
c213B10-G-12 linker
[2]
c213B10-E-13
c213B10-E-13 payload
Undisclosed
c213B10-E-13 linker
[2]
c213B10-F-13
c213B10-F-13 payload
Undisclosed
c213B10-F-13 linker
[2]
c213B10-G-13
c213B10-G-13 payload
Undisclosed
c213B10-G-13 linker
[2]
c213B10-E-15
c213B10-E-15 payload
Undisclosed
c213B10-E-15 linker
[2]
c213B10-G-15
c213B10-G-15 payload
Undisclosed
c213B10-G-15 linker
[2]
c213B10-F-61
c213B10-F-61 payload
Undisclosed
c213B10-F-61 linker
[2]
c213B10-F-62
c213B10-F-62 payload
Undisclosed
c213B10-F-62 linker
[2]
c213B10-F-63
c213B10-F-63 payload
Undisclosed
c213B10-F-63 linker
[2]
ADC Info ADC Name Payload Target Linker Ref
c214F8-E-11
c214F8-E-11 payload
Undisclosed
c214F8-E-11 linker
[2]
c214F8-E-12
c214F8-E-12 payload
Undisclosed
c214F8-E-12 linker
[2]
c214F8-G-12
c214F8-G-12 payload
Undisclosed
c214F8-G-12 linker
[2]
c214F8-E-13
c214F8-E-13 payload
Undisclosed
c214F8-E-13 linker
[2]
c214F8-F-13
c214F8-F-13 payload
Undisclosed
c214F8-F-13 linker
[2]
c214F8-G-13
c214F8-G-13 payload
Undisclosed
c214F8-G-13 linker
[2]
c214F8-E-15
c214F8-E-15 payload
Undisclosed
c214F8-E-15 linker
[2]
c214F8-G-15
c214F8-G-15 payload
Undisclosed
c214F8-G-15 linker
[2]
c214F8-F-61
c214F8-F-61 payload
Undisclosed
c214F8-F-61 linker
[2]
c214F8-F-62
c214F8-F-62 payload
Undisclosed
c214F8-F-62 linker
[2]
c214F8-F-63
c214F8-F-63 payload
Undisclosed
c214F8-F-63 linker
[2]
ADC Info ADC Name Payload Target Linker Ref
c219D6-E-11
c219D6-E-11 payload
Undisclosed
c219D6-E-11 linker
[2]
c219D6-E-12
c219D6-E-12 payload
Undisclosed
c219D6-E-12 linker
[2]
c219D6-G-12
c219D6-G-12 payload
Undisclosed
c219D6-G-12 linker
[2]
c219D6-E-13
c219D6-E-13 payload
Undisclosed
c219D6-E-13 linker
[2]
c219D6-F-13
c219D6-F-13 payload
Undisclosed
c219D6-F-13 linker
[2]
c219D6-G-13
c219D6-G-13 payload
Undisclosed
c219D6-G-13 linker
[2]
c219D6-E-15
c219D6-E-15 payload
Undisclosed
c219D6-E-15 linker
[2]
c219D6-G-15
c219D6-G-15 payload
Undisclosed
c219D6-G-15 linker
[2]
c219D6-F-61
c219D6-F-61 payload
Undisclosed
c219D6-F-61 linker
[2]
c219D6-F-62
c219D6-F-62 payload
Undisclosed
c219D6-F-62 linker
[2]
c219D6-F-63
c219D6-F-63 payload
Undisclosed
c219D6-F-63 linker
[2]
hz208F2 (var. 1)
ADC Info ADC Name Payload Target Linker Ref
hz208F2 (var. 1)-E-11
hz208F2 (var. 1)-E-11 payload
Undisclosed
hz208F2 (var. 1)-E-11 linker
[2]
hz208F2 (var. 1)-E-12
hz208F2 (var. 1)-E-12 payload
Undisclosed
hz208F2 (var. 1)-E-12 linker
[2]
hz208F2 (var. 1)-G-12
hz208F2 (var. 1)-G-12 payload
Undisclosed
hz208F2 (var. 1)-G-12 linker
[2]
hz208F2 (var. 1)-E-13
hz208F2 (var. 1)-E-13 payload
Undisclosed
hz208F2 (var. 1)-E-13 linker
[2]
hz208F2 (var. 1)-F-13
hz208F2 (var. 1)-F-13 payload
Undisclosed
hz208F2 (var. 1)-F-13 linker
[2]
hz208F2 (var. 1)-G-13
hz208F2 (var. 1)-G-13 payload
Undisclosed
hz208F2 (var. 1)-G-13 linker
[2]
hz208F2 (var. 1)-E-15
hz208F2 (var. 1)-E-15 payload
Undisclosed
hz208F2 (var. 1)-E-15 linker
[2]
hz208F2 (var. 1)-G-15
hz208F2 (var. 1)-G-15 payload
Undisclosed
hz208F2 (var. 1)-G-15 linker
[2]
hz208F2 (var. 1)-F-61
hz208F2 (var. 1)-F-61 payload
Undisclosed
hz208F2 (var. 1)-F-61 linker
[2]
hz208F2 (var. 1)-F-62
hz208F2 (var. 1)-F-62 payload
Undisclosed
hz208F2 (var. 1)-F-62 linker
[2]
hz208F2 (var. 1)-F-63
hz208F2 (var. 1)-F-63 payload
Undisclosed
hz208F2 (var. 1)-F-63 linker
[2]
hz208F2 (var. 2)
ADC Info ADC Name Payload Target Linker Ref
hz208F2 (var. 2)-E-11
hz208F2 (var. 2)-E-11 payload
Undisclosed
hz208F2 (var. 2)-E-11 linker
[2]
hz208F2 (var. 2)-E-12
hz208F2 (var. 2)-E-12 payload
Undisclosed
hz208F2 (var. 2)-E-12 linker
[2]
hz208F2 (var. 2)-G-12
hz208F2 (var. 2)-G-12 payload
Undisclosed
hz208F2 (var. 2)-G-12 linker
[2]
hz208F2 (var. 2)-E-13
hz208F2 (var. 2)-E-13 payload
Undisclosed
hz208F2 (var. 2)-E-13 linker
[2]
hz208F2 (var. 2)-F-13
hz208F2 (var. 2)-F-13 payload
Undisclosed
hz208F2 (var. 2)-F-13 linker
[2]
hz208F2 (var. 2)-G-13
hz208F2 (var. 2)-G-13 payload
Undisclosed
hz208F2 (var. 2)-G-13 linker
[2]
hz208F2 (var. 2)-E-15
hz208F2 (var. 2)-E-15 payload
Undisclosed
hz208F2 (var. 2)-E-15 linker
[2]
hz208F2 (var. 2)-G-15
hz208F2 (var. 2)-G-15 payload
Undisclosed
hz208F2 (var. 2)-G-15 linker
[2]
hz208F2 (var. 2)-F-61
hz208F2 (var. 2)-F-61 payload
Undisclosed
hz208F2 (var. 2)-F-61 linker
[2]
hz208F2 (var. 2)-F-62
hz208F2 (var. 2)-F-62 payload
Undisclosed
hz208F2 (var. 2)-F-62 linker
[2]
hz208F2 (var. 2)-F-63
hz208F2 (var. 2)-F-63 payload
Undisclosed
hz208F2 (var. 2)-F-63 linker
[2]
hz208F2 (var. 3)
ADC Info ADC Name Payload Target Linker Ref
hz208F2 (var. 3)-E-11
hz208F2 (var. 3)-E-11 payload
Undisclosed
hz208F2 (var. 3)-E-11 linker
[2]
hz208F2 (var. 3)-E-12
hz208F2 (var. 3)-E-12 payload
Undisclosed
hz208F2 (var. 3)-E-12 linker
[2]
hz208F2 (var. 3)-G-12
hz208F2 (var. 3)-G-12 payload
Undisclosed
hz208F2 (var. 3)-G-12 linker
[2]
hz208F2 (var. 3)-E-13
hz208F2 (var. 3)-E-13 payload
Undisclosed
hz208F2 (var. 3)-E-13 linker
[2]
hz208F2 (var. 3)-F-13
hz208F2 (var. 3)-F-13 payload
Undisclosed
hz208F2 (var. 3)-F-13 linker
[2]
hz208F2 (var. 3)-G-13
hz208F2 (var. 3)-G-13 payload
Undisclosed
hz208F2 (var. 3)-G-13 linker
[2]
hz208F2 (var. 3)-E-15
hz208F2 (var. 3)-E-15 payload
Undisclosed
hz208F2 (var. 3)-E-15 linker
[2]
hz208F2 (var. 3)-G-15
hz208F2 (var. 3)-G-15 payload
Undisclosed
hz208F2 (var. 3)-G-15 linker
[2]
hz208F2 (var. 3)-F-61
hz208F2 (var. 3)-F-61 payload
Undisclosed
hz208F2 (var. 3)-F-61 linker
[2]
hz208F2 (var. 3)-F-62
hz208F2 (var. 3)-F-62 payload
Undisclosed
hz208F2 (var. 3)-F-62 linker
[2]
hz208F2 (var. 3)-F-63
hz208F2 (var. 3)-F-63 payload
Undisclosed
hz208F2 (var. 3)-F-63 linker
[2]
Lonigutamab
ADC Info ADC Name Payload Target Linker Ref
Lonigutamab ugodotin
F554443
Microtubule (MT)
Maleimido-caproyl
[3]
ADC Info ADC Name Payload Target Linker Ref
m208F2-E-11
m208F2-E-11 payload
Undisclosed
m208F2-E-11 linker
[2]
m208F2-E-12
m208F2-E-12 payload
Undisclosed
m208F2-E-12 linker
[2]
m208F2-G-12
m208F2-G-12 payload
Undisclosed
m208F2-G-12 linker
[2]
m208F2-E-13
m208F2-E-13 payload
Undisclosed
m208F2-E-13 linker
[2]
m208F2-F-13
m208F2-F-13 payload
Undisclosed
m208F2-F-13 linker
[2]
m208F2-G-13
m208F2-G-13 payload
Undisclosed
m208F2-G-13 linker
[2]
m208F2-E-15
m208F2-E-15 payload
Undisclosed
m208F2-E-15 linker
[2]
m208F2-G-15
m208F2-G-15 payload
Undisclosed
m208F2-G-15 linker
[2]
m208F2-F-61
m208F2-F-61 payload
Undisclosed
m208F2-F-61 linker
[2]
m208F2-F-62
m208F2-F-62 payload
Undisclosed
m208F2-F-62 linker
[2]
m208F2-F-63
m208F2-F-63 payload
Undisclosed
m208F2-F-63 linker
[2]
ADC Info ADC Name Payload Target Linker Ref
m212A11-E-11
m212A11-E-11 payload
Undisclosed
m212A11-E-11 linker
[2]
m212A11-E-12
m212A11-E-12 payload
Undisclosed
m212A11-E-12 linker
[2]
m212A11-G-12
m212A11-G-12 payload
Undisclosed
m212A11-G-12 linker
[2]
m212A11-E-13
m212A11-E-13 payload
Undisclosed
m212A11-E-13 linker
[2]
m212A11-F-13
m212A11-F-13 payload
Undisclosed
m212A11-F-13 linker
[2]
m212A11-G-13
m212A11-G-13 payload
Undisclosed
m212A11-G-13 linker
[2]
m212A11-E-15
m212A11-E-15 payload
Undisclosed
m212A11-E-15 linker
[2]
m212A11-G-15
m212A11-G-15 payload
Undisclosed
m212A11-G-15 linker
[2]
m212A11-F-61
m212A11-F-61 payload
Undisclosed
m212A11-F-61 linker
[2]
m212A11-F-62
m212A11-F-62 payload
Undisclosed
m212A11-F-62 linker
[2]
m212A11-F-63
m212A11-F-63 payload
Undisclosed
m212A11-F-63 linker
[2]
ADC Info ADC Name Payload Target Linker Ref
m213B10-E-11
m213B10-E-11 payload
Undisclosed
m213B10-E-11 linker
[2]
m213B10-E-12
m213B10-E-12 payload
Undisclosed
m213B10-E-12 linker
[2]
m213B10-G-12
m213B10-G-12 payload
Undisclosed
m213B10-G-12 linker
[2]
m213B10-E-13
m213B10-E-13 payload
Undisclosed
m213B10-E-13 linker
[2]
m213B10-F-13
m213B10-F-13 payload
Undisclosed
m213B10-F-13 linker
[2]
m213B10-G-13
m213B10-G-13 payload
Undisclosed
m213B10-G-13 linker
[2]
m213B10-E-15
m213B10-E-15 payload
Undisclosed
m213B10-E-15 linker
[2]
m213B10-G-15
m213B10-G-15 payload
Undisclosed
m213B10-G-15 linker
[2]
m213B10-F-61
m213B10-F-61 payload
Undisclosed
m213B10-F-61 linker
[2]
m213B10-F-62
m213B10-F-62 payload
Undisclosed
m213B10-F-62 linker
[2]
m213B10-F-63
m213B10-F-63 payload
Undisclosed
m213B10-F-63 linker
[2]
ADC Info ADC Name Payload Target Linker Ref
m214F8-E-11
m214F8-E-11 payload
Undisclosed
m214F8-E-11 linker
[2]
m214F8-E-12
m214F8-E-12 payload
Undisclosed
m214F8-E-12 linker
[2]
m214F8-G-12
m214F8-G-12 payload
Undisclosed
m214F8-G-12 linker
[2]
m214F8-E-13
m214F8-E-13 payload
Undisclosed
m214F8-E-13 linker
[2]
m214F8-F-13
m214F8-F-13 payload
Undisclosed
m214F8-F-13 linker
[2]
m214F8-G-13
m214F8-G-13 payload
Undisclosed
m214F8-G-13 linker
[2]
m214F8-E-15
m214F8-E-15 payload
Undisclosed
m214F8-E-15 linker
[2]
m214F8-G-15
m214F8-G-15 payload
Undisclosed
m214F8-G-15 linker
[2]
m214F8-F-61
m214F8-F-61 payload
Undisclosed
m214F8-F-61 linker
[2]
m214F8-F-62
m214F8-F-62 payload
Undisclosed
m214F8-F-62 linker
[2]
m214F8-F-63
m214F8-F-63 payload
Undisclosed
m214F8-F-63 linker
[2]
ADC Info ADC Name Payload Target Linker Ref
m219D6-E-11
m219D6-E-11 payload
Undisclosed
m219D6-E-11 linker
[2]
m219D6-E-12
m219D6-E-12 payload
Undisclosed
m219D6-E-12 linker
[2]
m219D6-G-12
m219D6-G-12 payload
Undisclosed
m219D6-G-12 linker
[2]
m219D6-E-13
m219D6-E-13 payload
Undisclosed
m219D6-E-13 linker
[2]
m219D6-F-13
m219D6-F-13 payload
Undisclosed
m219D6-F-13 linker
[2]
m219D6-G-13
m219D6-G-13 payload
Undisclosed
m219D6-G-13 linker
[2]
m219D6-E-15
m219D6-E-15 payload
Undisclosed
m219D6-E-15 linker
[2]
m219D6-G-15
m219D6-G-15 payload
Undisclosed
m219D6-G-15 linker
[2]
m219D6-F-61
m219D6-F-61 payload
Undisclosed
m219D6-F-61 linker
[2]
m219D6-F-62
m219D6-F-62 payload
Undisclosed
m219D6-F-62 linker
[2]
m219D6-F-63
m219D6-F-63 payload
Undisclosed
m219D6-F-63 linker
[2]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
ANT-045
Undisclosed
Undisclosed
Undisclosed
[4]
IGF-1R targeting monoclonal antibody-drug conjugate
Undisclosed
Undisclosed
Undisclosed
[5]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.63E-11; Fold-change: -0.442500756; Z-score: -0.897863037
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.082044935; Fold-change: 1.397747074; Z-score: 3.557366415
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.127997281; Fold-change: 0.191256051; Z-score: 0.230204792
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.176712779; Fold-change: 0.435756737; Z-score: 0.907430223
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000158232; Fold-change: 0.119770012; Z-score: 0.261163022
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.481774139; Fold-change: 0.032560941; Z-score: 0.117268866
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.040937839; Fold-change: -0.377007375; Z-score: -1.217627961
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.089167315; Fold-change: 0.237712778; Z-score: 0.490098755
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.089358393; Fold-change: 0.442256155; Z-score: 1.13188501
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.982753223; Fold-change: -0.222863716; Z-score: -1.19650254
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.117110822; Fold-change: -0.384753904; Z-score: -1.473708657
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.596846053; Fold-change: 0.097722129; Z-score: 0.22840913
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005317572; Fold-change: -0.134354186; Z-score: -0.242306489
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 8.29E-19; Fold-change: 0.642395094; Z-score: 1.054880043
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.348134923; Fold-change: 0.168752174; Z-score: 0.350399563
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001394457; Fold-change: -0.252079065; Z-score: -0.438266115
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.038215867; Fold-change: -0.193522593; Z-score: -0.799103801
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 3.53E-05; Fold-change: -0.055497842; Z-score: -0.177343062
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.492240217; Fold-change: -0.158405516; Z-score: -0.526701327
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000694775; Fold-change: 0.110909973; Z-score: 0.190211207
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.613544303; Fold-change: -0.090152744; Z-score: -0.118475835
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004567537; Fold-change: 1.087424562; Z-score: 0.9518232
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.02E-58; Fold-change: 0.778062849; Z-score: 2.189198914
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.014829039; Fold-change: 0.753664632; Z-score: 2.091012717
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.93E-08; Fold-change: 0.538779289; Z-score: 0.573652029
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002308664; Fold-change: 0.500396389; Z-score: 0.44999777
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007033947; Fold-change: -0.750246734; Z-score: -1.356470616
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.004864586; Fold-change: 0.479805825; Z-score: 1.201096274
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.026861994; Fold-change: 0.064368924; Z-score: 0.202173111
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 7.71E-06; Fold-change: -0.441337329; Z-score: -0.637468572
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.022750911; Fold-change: 1.285377465; Z-score: 1.98955464
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.005575866; Fold-change: -1.225773778; Z-score: -1.028250291
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.52E-07; Fold-change: -1.185525673; Z-score: -4.563174495
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.64E-05; Fold-change: 1.06289599; Z-score: 3.877593201
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000145038; Fold-change: -0.465668794; Z-score: -0.613645459
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.924305857; Fold-change: 0.021639597; Z-score: 0.033481886
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.066196115; Fold-change: -0.243121574; Z-score: -0.665463139
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.53E-08; Fold-change: 0.667740173; Z-score: 0.950117806
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.101336791; Fold-change: 0.557048376; Z-score: 1.259957562
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.395268062; Fold-change: 0.377799373; Z-score: 0.793929752
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.331934482; Fold-change: -0.413903937; Z-score: -0.558311102
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.78E-08; Fold-change: -0.552809546; Z-score: -0.748404034
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.662696569; Fold-change: -0.143050986; Z-score: -1.029782653
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.45E-07; Fold-change: -1.403759429; Z-score: -2.229898268
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006125193; Fold-change: 0.14045966; Z-score: 0.889643128
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.730165464; Fold-change: -0.007402581; Z-score: -0.019545159
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.117723577; Fold-change: 0.091600399; Z-score: 0.706223155
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.41902964; Fold-change: -0.015568245; Z-score: -0.095671903
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.019947998; Fold-change: 0.121952527; Z-score: 0.288586757
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.167856826; Fold-change: -0.251625249; Z-score: -0.752042188
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.811763709; Fold-change: -0.081625946; Z-score: -0.321269811
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.657201317; Fold-change: 0.077484919; Z-score: 0.33104135
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.154081033; Fold-change: 0.137067754; Z-score: 0.273269527
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.09E-06; Fold-change: 0.638497246; Z-score: 0.829249596
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.76E-20; Fold-change: 0.989483118; Z-score: 1.17646007
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.769678229; Fold-change: 0.021811262; Z-score: 0.056939899
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.40740188; Fold-change: -0.765467735; Z-score: -50.27000292
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.254491247; Fold-change: 0.205789794; Z-score: 0.143414726
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.604030104; Fold-change: 0.048870111; Z-score: 0.196609221
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.262137152; Fold-change: -0.025928727; Z-score: -0.169403991
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.955233012; Fold-change: -0.040073352; Z-score: -0.061521076
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.031271449; Fold-change: -1.123930169; Z-score: -2.056788279
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.85362185; Fold-change: 0.026083878; Z-score: 0.248799196
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.097884992; Fold-change: -0.134518876; Z-score: -0.576171518
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.53762411; Fold-change: -0.240206597; Z-score: -0.259511853
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.959182447; Fold-change: -0.244169926; Z-score: -0.470510606
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.839174339; Fold-change: -0.055762564; Z-score: -0.106039917
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.760295169; Fold-change: -0.037038458; Z-score: -0.068591066
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.20480507; Fold-change: 0.004232361; Z-score: 0.006105265
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.14085179; Fold-change: -0.083640793; Z-score: -0.389453027
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000335277; Fold-change: -0.782026016; Z-score: -3.01816297
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.06E-10; Fold-change: -0.52902579; Z-score: -1.063372497
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.221798083; Fold-change: 0.290802502; Z-score: 1.476291251
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.109434844; Fold-change: 0.154788887; Z-score: 0.644076696
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.414806444; Fold-change: -0.012693831; Z-score: -0.042754642
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.176956583; Fold-change: -0.06899809; Z-score: -0.206091946
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.696843413; Fold-change: 0.162991814; Z-score: 0.500076664
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.24E-17; Fold-change: -0.628426573; Z-score: -0.876501172
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.63E-34; Fold-change: 1.431936096; Z-score: 3.088568857
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.462662592; Fold-change: 0.427621179; Z-score: 1.059900414
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.017886574; Fold-change: -0.305372386; Z-score: -0.779994051
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.784029371; Fold-change: -0.049329366; Z-score: -0.107533442
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.034576251; Fold-change: 0.208004585; Z-score: 1.128041741
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.017113052; Fold-change: 0.198659174; Z-score: 0.718696573
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.537546273; Fold-change: -0.056316686; Z-score: -0.058603804
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.96E-08; Fold-change: 1.608745106; Z-score: 6.230869441
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.415030865; Fold-change: -0.044574836; Z-score: -0.12173723
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.73083094; Fold-change: -0.168046097; Z-score: -0.389443588
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.057438972; Fold-change: 0.090382141; Z-score: 0.113477406
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000536837; Fold-change: -0.797670176; Z-score: -3.392198364
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.199324135; Fold-change: -0.335270854; Z-score: -0.579066401
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.98E-12; Fold-change: -0.629747634; Z-score: -0.95761876
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.561228537; Fold-change: -0.00826103; Z-score: -0.04042982
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.554151107; Fold-change: 0.240589797; Z-score: 0.235927605
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.17E-09; Fold-change: 1.17725421; Z-score: 1.987339106
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.73E-05; Fold-change: 0.552741675; Z-score: 0.781500823
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.795483624; Fold-change: -0.045154167; Z-score: -0.082868637
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.164250989; Fold-change: 0.254781442; Z-score: 0.644711173
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.045295797; Fold-change: 0.264489167; Z-score: 1.201194396
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.66E-05; Fold-change: -0.547135324; Z-score: -0.562307681
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.29E-23; Fold-change: 1.072244339; Z-score: 1.364970032
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004519855; Fold-change: -0.364927575; Z-score: -1.025021097
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.776800135; Fold-change: 0.024031433; Z-score: 0.045067783
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.946840514; Fold-change: 0.087323568; Z-score: 0.264260952
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.127041819; Fold-change: 0.258300108; Z-score: 0.960607857
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.838970682; Fold-change: 0.04447604; Z-score: 0.180076829
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.397354147; Fold-change: -0.303287754; Z-score: -1.099810904
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.04638602; Fold-change: 0.135007096; Z-score: 0.417211617
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.878600462; Fold-change: 0.00284905; Z-score: 0.009286068
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.195780831; Fold-change: -0.044266626; Z-score: -0.084052981
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.318582315; Fold-change: 0.76025315; Z-score: 1.412892269
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.045515817; Fold-change: 0.689897452; Z-score: 2.087682488
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.223339684; Fold-change: -0.44750483; Z-score: -0.844774565
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.34E-05; Fold-change: -0.920643941; Z-score: -2.32422038
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.809073463; Fold-change: -0.093932986; Z-score: -0.591757032
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.06639175; Fold-change: -0.221180377; Z-score: -1.620458384
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.287339846; Fold-change: 0.100011911; Z-score: 0.322361125
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.113345768; Fold-change: -0.196208597; Z-score: -0.344351173
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.103398401; Fold-change: -0.138179311; Z-score: -0.540698616
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.225186897; Fold-change: 0.219084337; Z-score: 0.39194472
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.595160857; Fold-change: 0.070130179; Z-score: 0.126781999
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.431142316; Fold-change: 0.158121254; Z-score: 0.321460672
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.855165849; Fold-change: 0.015239113; Z-score: 0.055015651
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.60E-06; Fold-change: 0.199858963; Z-score: 0.728475092
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.332010242; Fold-change: -0.083119802; Z-score: -0.130344114
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.025225743; Fold-change: -1.195999793; Z-score: -2.218968736
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.211855742; Fold-change: -0.200963197; Z-score: -0.372170612
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.301584246; Fold-change: -0.257447989; Z-score: -0.493828568
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.039053504; Fold-change: -0.64470327; Z-score: -1.183001691
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 IGF Oncology biotechnology company product pipeline
Ref 2 Antibody-drug-conjugate and its use for the treatment of cancer.
Ref 3 Efficacy of the Antibody-Drug Conjugate W0101 in Preclinical Models of IGF-1 Receptor Overexpressing Solid Tumors. Mol Cancer Ther. 2020 Jan;19(1):168-177.
Ref 4 Antibody fragment drug-conjugates (FDCs)-application of ANT-043 and ANT-045 in solid tumors. Cancer Res (2021) 81 (13_Supplement): 909.
Ref 5 Sorrento therapeutics next-generation targeted and personalized cancer therapeutics; 2013

If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.