General Information of This Antigen
Antigen ID
TAR0IBZAS
Antigen Name
Claudin-18.2 (CLDN18.2)
Gene Name
CLDN18.2
Gene ID
51208
Sequence
MSTTTCQVVAFLLSILGLAGCIAATGMDMWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGF
TECRPYFTILGLPAMLQAVRALMIVGIVLGAIGLLVSIFALKCIRIGSMEDSAKANMTLT
SGIMFIVSGLCAIAGVSVFANMLVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWV
AGGLTLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKI
YDGGARTEDEVQSYPSKHDYV

    Click to Show/Hide
Family
CD99 family
Function
Involved in alveolar fluid homeostasis via regulation of alveolar epithelial tight junction composition and therefore ion transport and solute permeability, potentially via downstream regulation of the actin cytoskeleton organization and beta-2-adrenergic signaling. Required for lung alveolarization and maintenance of the paracellular alveolar epithelial barrier. Acts to maintain epithelial progenitor cell proliferation and organ size, via regulation of YAP1 localization away from the nucleus and thereby restriction of YAP1 target gene transcription. Acts as a negative regulator of RANKL-induced osteoclast differentiation, potentially via relocation of TJP2/ZO-2 away from the nucleus, subsequently involved in bone resorption in response to calcium deficiency. Mediates the osteoprotective effects of estrogen, potentially via acting downstream of estrogen signaling independently of RANKL signaling pathways.

    Click to Show/Hide
Uniprot Entry
CLD18_HUMAN
HGNC ID
HGNC:2039
KEGG ID
hsa:51208
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
A fully humanized anti-CLDN18.2 monoclonal antibody
ADC Info ADC Name Payload Target Linker Ref
IBI-343
Exatecan
DNA topoisomerase 1 (TOP1)
Synaffix linker
[1]
A humanized anti-CLDN18.2 IgG1 monoclonal antibody
ADC Info ADC Name Payload Target Linker Ref
TQB2103
2-DDDX-d
DNA topoisomerase 1 (TOP1)
Mc-Gly-Gly-Phe-Gly
[2]
A humanized IgG1 monoclonal antibody targeting CLDN18.2
ADC Info ADC Name Payload Target Linker Ref
SHR-A1904
SHR9265
DNA topoisomerase 1 (TOP1)
Mc-Gly-Gly-Phe-Gly
[3]
Anti-CLDN18.2 mAb
ADC Info ADC Name Payload Target Linker Ref
LM-302
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[4]
CN107667118A ADC-1
CN107667118A ADC-1 linker payload
Undisclosed
CN107667118A ADC-1 linker
[5]
CN107667118A ADC-2
CN107667118A ADC-2 linker payload
Undisclosed
CN107667118A ADC-2 linker
[5]
Anti-CLDN18.2 mAb SYSA-1801
ADC Info ADC Name Payload Target Linker Ref
SYSA-1801
Monomethyl auristatin E
Microtubule (MT)
PEG3-Val-Cit-PABC
[6]
Ciletatug
ADC Info ADC Name Payload Target Linker Ref
RC-118
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[7]
ADC Info ADC Name Payload Target Linker Ref
WO2021115426A1 ADC-2
WO2021115426A1 ADC-2 payload
Undisclosed
WO2021115426A1 ADC-2 linker
[8]
WO2021115426A1 ADC-3
WO2021115426A1 ADC-3 payload
Undisclosed
WO2021115426A1 ADC-3 linker
[8]
WO2021115426A1 ADC-4
WO2021115426A1 ADC-4 payload
Undisclosed
WO2021115426A1 ADC-4 linker
[8]
WO2021115426A1 ADC-5
WO2021115426A1 ADC-5 payload
Undisclosed
WO2021115426A1 ADC-5 linker
[8]
ADC Info ADC Name Payload Target Linker Ref
WO2021115426A1 ADC-1
WO2021115426A1 ADC-1 payload
Undisclosed
WO2021115426A1 ADC-1 linker
[8]
WO2021115426A1 ADC-6
WO2021115426A1 ADC-6 payload
Undisclosed
WO2021115426A1 ADC-6 linker
[8]
WO2021115426A1 ADC-7
WO2021115426A1 ADC-7 payload
Undisclosed
WO2021115426A1 ADC-7 linker
[8]
WO2021115426A1 ADC-8
WO2021115426A1 ADC-8 payload
Undisclosed
WO2021115426A1 ADC-8 linker
[8]
WO2021115426A1 ADC-9
WO2021115426A1 ADC-9 payload
Undisclosed
WO2021115426A1 ADC-9 linker
[8]
ADC Info ADC Name Payload Target Linker Ref
IMAB362-MC-Val-Cit-PAB-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[9]
IMAB362-Val-Cit-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[10]
RGCLN18.2
ADC Info ADC Name Payload Target Linker Ref
RGCLN18.2-D07-Val-Cit-PAB-MMAE
Monomethyl auristatin E
Microtubule (MT)
D07-Val-Cit-PABC
[9]
RGCLN18.2-MC-Val-Cit-PAB-MMAE
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[9]
RGCLN18.2-PY-Val-Cit-PAB-MMAE
Monomethyl auristatin E
Microtubule (MT)
PY-VC-PABC
[9]
Sonesitatug
ADC Info ADC Name Payload Target Linker Ref
CMG-901
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[11]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
XNW-27011
YL0010014
DNA topoisomerase 1 (TOP1)
Tumor microenviroment activable tripeptide linker
[12]
SOT-102
PNU-159682
DNA topoisomerase 2-alpha (TOP2A)
Pentaglycine-EDA (Non-cleavable)
[13]
ATG-022
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[14]
BA-1301
Duostatin 5
Microtubule (MT)
Undisclosed
[15]
BL-M05D1
Camptothecin analogue ED04
DNA topoisomerase 1 (TOP1)
Undisclosed
[16]
JS107
Monomethyl auristatin E
Microtubule (MT)
Undisclosed
[17]
SKB-315
Topoisomerase I inhibitor
DNA topoisomerase 1 (TOP1)
Stable linker
[18]
TORL-2-307-ADC
Monomethyl auristatin E
Microtubule (MT)
Cleavable linker
[19]
Alpha-CLDN-VC0101
Auristatin 0101
Microtubule (MT)
Mc-Val-Cit-PABC
[20]
BSI-077
Undisclosed
Undisclosed
Undisclosed
[21]
BSI-706
Undisclosed
Undisclosed
Undisclosed
[22]
LNL-008
Undisclosed
Undisclosed
Undisclosed
[23]
MIL-106
Undisclosed
Undisclosed
Undisclosed
[24]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.03231353; Fold-change: -0.062255667; Z-score: -0.229326562
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.565276922; Fold-change: -0.05139265; Z-score: -0.566315103
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.75E-07; Fold-change: -0.408659737; Z-score: -2.738357971
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007469845; Fold-change: -0.498175425; Z-score: -1.103841946
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.002914427; Fold-change: 0.051051569; Z-score: 0.23429931
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.147237597; Fold-change: 0.024179024; Z-score: 0.199341041
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.109751824; Fold-change: -0.080977875; Z-score: -0.630785431
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.222712038; Fold-change: -0.034544695; Z-score: -0.302738244
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.065285378; Fold-change: -0.166412198; Z-score: -1.73770895
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.806139576; Fold-change: 0.066300805; Z-score: 0.354585329
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.446259014; Fold-change: -1.992780479; Z-score: -0.744845678
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.74E-06; Fold-change: -2.250530699; Z-score: -1.420268489
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.19E-17; Fold-change: 0.053146205; Z-score: 0.278682275
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 7.25E-08; Fold-change: -0.031460514; Z-score: -0.136182584
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.07E-06; Fold-change: 3.556470461; Z-score: 2.401946489
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 2.41E-21; Fold-change: 3.343681467; Z-score: 2.686614797
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.009459377; Fold-change: -0.15143292; Z-score: -0.778617552
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.528073746; Fold-change: -0.050639775; Z-score: -0.29615375
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.923113023; Fold-change: -0.048577235; Z-score: -0.349327869
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.25E-123; Fold-change: -5.784306442; Z-score: -4.330385256
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.11E-59; Fold-change: -5.148517574; Z-score: -3.376276337
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.969954058; Fold-change: 0.050441008; Z-score: 0.168038007
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.65E-09; Fold-change: -0.174086482; Z-score: -0.970676351
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.585917232; Fold-change: -0.012532775; Z-score: -0.111758877
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.08E-05; Fold-change: -0.047673271; Z-score: -0.223354222
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.862937455; Fold-change: -0.006785987; Z-score: -0.029564821
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.529965027; Fold-change: -0.082431827; Z-score: -0.360160596
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.833953021; Fold-change: -0.09982784; Z-score: -0.351675562
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.046694958; Fold-change: -0.077554802; Z-score: -0.448296825
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.050761076; Fold-change: -0.026293151; Z-score: -0.112333569
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.348145459; Fold-change: -0.005489941; Z-score: -0.029552934
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.696219276; Fold-change: 0.024774022; Z-score: 0.081483056
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000832386; Fold-change: 0.478898246; Z-score: 2.120885719
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003689211; Fold-change: -0.298702586; Z-score: -4.237267118
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.091146495; Fold-change: 0.036614969; Z-score: 0.172743546
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.223519159; Fold-change: 0.028563335; Z-score: 0.153574245
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.051298935; Fold-change: -0.021745707; Z-score: -0.257361366
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.378599537; Fold-change: -0.013083628; Z-score: -0.079615973
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.338913734; Fold-change: -0.117212114; Z-score: -0.851353577
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.718930098; Fold-change: -0.014317468; Z-score: -0.072681724
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.679835925; Fold-change: 0.050930968; Z-score: 0.586387866
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.953593385; Fold-change: -0.035174756; Z-score: -0.122414252
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.09380479; Fold-change: -0.106087897; Z-score: -0.855188445
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.128731519; Fold-change: -0.149800883; Z-score: -0.708215335
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.12994075; Fold-change: -0.061395612; Z-score: -0.578706103
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.510035078; Fold-change: -0.035516294; Z-score: -0.242395867
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.507099761; Fold-change: 0.093369038; Z-score: 0.344928826
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.735662956; Fold-change: 0.027907574; Z-score: 0.352684675
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014488837; Fold-change: 0.056884525; Z-score: 0.375273469
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.879973267; Fold-change: -0.040575365; Z-score: -0.276795294
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.450860181; Fold-change: 0.040655154; Z-score: 0.15133105
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.171337789; Fold-change: 0.280360323; Z-score: 1.168533653
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.285684298; Fold-change: 0.165236963; Z-score: 1.126225082
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.225385433; Fold-change: 0.037733245; Z-score: 0.181161247
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.01E-12; Fold-change: 0.12332913; Z-score: 0.614425034
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.413359331; Fold-change: -0.020150061; Z-score: -0.185951906
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.921301476; Fold-change: -0.057729357; Z-score: -1.205471649
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.012128745; Fold-change: 0.191734306; Z-score: 0.57841276
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.910189655; Fold-change: -0.029160219; Z-score: -0.403166367
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.390847342; Fold-change: 0.387324723; Z-score: 0.593051861
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.793114636; Fold-change: -0.016060851; Z-score: -0.148592547
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.184361986; Fold-change: 0.127286003; Z-score: 1.091870109
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.137554859; Fold-change: 0.028535659; Z-score: 0.254931183
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.199958575; Fold-change: -0.123171564; Z-score: -0.725954492
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.359282622; Fold-change: 0.023384318; Z-score: 0.138969447
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.32858463; Fold-change: 0.071177199; Z-score: 0.713417889
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.527566702; Fold-change: -0.135093421; Z-score: -0.120747035
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.016803677; Fold-change: 0.127474728; Z-score: 0.542325762
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.62E-05; Fold-change: -0.131721474; Z-score: -0.106674112
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.865716983; Fold-change: 0.002926629; Z-score: 0.023556621
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004613788; Fold-change: -1.017702045; Z-score: -1.597146208
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.492075107; Fold-change: 0.018518043; Z-score: 0.064008564
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.902732106; Fold-change: -0.002250213; Z-score: -0.012192701
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.75013626; Fold-change: 0.100409862; Z-score: 1.001285489
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.346790057; Fold-change: -0.031772422; Z-score: -0.123958157
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.347633504; Fold-change: 0.063344775; Z-score: 0.244402631
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.041134445; Fold-change: 0.054170056; Z-score: 0.588882585
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.949976578; Fold-change: 0.022311748; Z-score: 0.081386351
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000947974; Fold-change: -0.093800234; Z-score: -0.379037858
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.346309218; Fold-change: -0.193520391; Z-score: -1.273491743
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.920256158; Fold-change: 0.032254232; Z-score: 0.123497595
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.613204295; Fold-change: -0.062818152; Z-score: -0.292065027
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.393367681; Fold-change: -0.020758494; Z-score: -0.116283259
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.30549902; Fold-change: 0.053868894; Z-score: 0.413408964
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.037725788; Fold-change: 0.050770051; Z-score: 0.250288786
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.139892427; Fold-change: -0.099128282; Z-score: -0.281179557
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.298277073; Fold-change: 0.053545202; Z-score: 0.492641958
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.058101242; Fold-change: 0.191745621; Z-score: 2.239402378
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.261105644; Fold-change: 0.056810433; Z-score: 0.330014461
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.284185244; Fold-change: 0.153042104; Z-score: 0.875107061
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.885143885; Fold-change: 0.009062452; Z-score: 0.073759959
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.781223212; Fold-change: 0.012174928; Z-score: 0.084589401
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.153331851; Fold-change: -0.111929003; Z-score: -0.991114768
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.706296038; Fold-change: 0.000307706; Z-score: 0.002072634
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.24E-07; Fold-change: -0.352156732; Z-score: -1.488756359
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.242878461; Fold-change: -0.092548901; Z-score: -0.311800905
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.75E-05; Fold-change: 0.134513602; Z-score: 1.08596367
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.988398041; Fold-change: -0.101556514; Z-score: -0.588385006
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.517168195; Fold-change: -0.033934468; Z-score: -0.146742441
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.719348284; Fold-change: -0.003231402; Z-score: -0.013499488
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.095396278; Fold-change: -0.026471122; Z-score: -0.099811454
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.78754859; Fold-change: -0.090666051; Z-score: -0.341536054
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.54E-05; Fold-change: -0.212225476; Z-score: -1.017078241
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.267680973; Fold-change: -0.047719374; Z-score: -0.32817258
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.774826081; Fold-change: 0.016532617; Z-score: 0.196161685
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.946982163; Fold-change: -0.012578248; Z-score: -0.140131826
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.189888519; Fold-change: 0.188432314; Z-score: 0.651250495
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.077861787; Fold-change: 0.080873156; Z-score: 0.675019968
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.442693965; Fold-change: 0.0461625; Z-score: 0.344437679
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.260343754; Fold-change: 0.043801836; Z-score: 0.365615062
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.51381548; Fold-change: -0.134070903; Z-score: -0.636797542
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.187292702; Fold-change: -0.097069583; Z-score: -1.181528894
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.77761531; Fold-change: -0.041181414; Z-score: -0.160666677
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.866611213; Fold-change: 0.027404669; Z-score: 0.132016601
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.941178631; Fold-change: 0.039764849; Z-score: 0.23466597
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.975930308; Fold-change: -0.002780761; Z-score: -0.027384388
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.468443406; Fold-change: -0.003511999; Z-score: -0.029604197
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.252964106; Fold-change: -0.03613742; Z-score: -0.445527297
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.060730078; Fold-change: 0.080999308; Z-score: 0.949074495
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.122735638; Fold-change: 0.0004478; Z-score: 0.00262035
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.346615029; Fold-change: -0.016153229; Z-score: -0.07596398
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.24136055; Fold-change: -0.15667422; Z-score: -1.15826109
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.402064145; Fold-change: 0.069496836; Z-score: 0.58868376
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.585233828; Fold-change: -0.000746241; Z-score: -0.005618357
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.620701288; Fold-change: -0.031803142; Z-score: -0.200541324
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.095991083; Fold-change: 0.273350649; Z-score: 1.204481967
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.058163849; Fold-change: 0.161984531; Z-score: 1.511603072
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001202135; Fold-change: -0.175122406; Z-score: -1.84778097
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.988997297; Fold-change: -0.034634755; Z-score: -0.282135118
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 A First-in-human Study of IBI343 in Subjects With Locally Advanced Unresectable or Metastatic Solid Tumors; NCT05458219.
Ref 2 Clinical trial evaluating the safety of the TQB2103 for injection; 2023
Ref 3 An Open-Label, Single-Arm, Multi-Center Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-A1904 in Patients With Advanced Pancreatic Cancer, NCT04928625
Ref 4 Study of Turning Point Therapeutics LM-302 in Patients With Advance Solid Tumors; NCT05001516.
Ref 5 Drug conjugates comprising antibodies against claudin 18.2.
Ref 6 Therapeutic potential of EO-3021/SYSA1801, a Claudin18.2 antibody-drug conjugate, for the treatment of CLDN18.2-expressing cancers. Cancer Res (2023) 83 (7_Supplement): 6300.
Ref 7 Introduction to basic information on ADC drug RC118.
Ref 8 Anti-claudin antibody-drug conjugate and pharmaceutical use thereof; 2021-06-17.
Ref 9 Anti-claudin 18.2 antibody and antibody-drug conjugate thereof; 2022-11-17.
Ref 10 Introduction to basic information on ADC drug IMAB362-VCMMAE.
Ref 11 Safety, Tolerability, Pharmacokinetics, and Preliminary Efficacy, Phase 1 Study of CMG901; NCT04805307.
Ref 12 Evopoint's first ADC approved in China for the treatment of patients with locally advanced unresectable or metastatic malignant solid tumors; 23 Apr 2023.
Ref 13 SOT102, a novel CLDN18.2-targeting antibody-drug conjugate for gastric and pancreatic cancer with a wide range of the tumor target expression. ESMO OPEN 2023 Mar; 8(1):supplement 101196.
Ref 14 A Study of ATG-022 in Patients With Advanced/Metastatic Solid Tumors (CLINCH); NCT05718895.
Ref 15 Boan biotechnology company product pipeline
Ref 16 Biokin pharma Prospectus; 2022
Ref 17 A Clinical Study to Evaluate the Safety and Tolerability of JS107 in Advanced or Metastatic Solid Tumors; NCT05502393.
Ref 18 A Study of SKB315 in Patients With Advanced Solid Tumors; NCT05367635.
Ref 19 TORL BioTherapeutics raises funds to develop new oncology therapies; 14 Apr 2023.
Ref 20 Targeting CLDN18.2 by CD3 Bispecific and ADC Modalities for the Treatments of Gastric and Pancreatic Cancer. Sci Rep. 2019 Jun 10;9(1):8420. doi: 10.1038/s41598-019-44874-0.
Ref 21 Introduction to basic information on ADC drug BSI-077.
Ref 22 Introduction to basic information on ADC drug BSI-706.
Ref 23 Introduction to basic information on ADC drug LNL-008.
Ref 24 Introduction to basic information on ADC drug MIL-106.