General Information of This Antibody
Antibody ID
ANI0RYL003
Antibody Name
Ciletatug
Antigen Name
Claudin-18.2 (CLDN18.2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYAFTNYLIEWVRAQPGWGLEWMGLINPGSGGTNY
NEKFKGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGYYGNSFAYWGQGTLVTVSS
    Click to Show/Hide
Light Chain Sequence
DIVMTQSPLSLPVTPGEPASISCKSSQSLLNSGNQKNYLTWYLQKPGQSPQLLIYWASTR
ESGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCQNAYYYPYTFGGGTKVEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
RC-118 [Phase 1/2]
Identified from the Human Clinical Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Related Clinical Trial
NCT Number NCT05205850  Clinical Status Phase 1
Clinical Description
An open, multi-center phase 1/2a clinical study of RC118 for injection in patients with locally advanced unresectable or metastatic malignant solid tumors with positive expression of CLAUDIN 18.2.
Experiment 2 Reporting the Activity Date of This ADC [2]
Related Clinical Trial
NCT Number NCT04914117  Clinical Status Phase 1
Clinical Description
Phase 1, first-in-human, multicentre, open-label study of RC118 for injection in patients with locally advanced unresectable/metastatic solid tumours.
Experiment 3 Reporting the Activity Date of This ADC [3]
Related Clinical Trial
NCT Number NCT03895112  Clinical Status Phase 1
Clinical Description
Phase 1 study of AVID200 in patients with myelofibrosis (myeloproliferative neoplasms research consortium [MPN-RC] 118).
References
Ref 1 An Open, Multi-center Phase I/IIa Clinical Study of RC118 for Injection in Patients With Locally Advanced Unresectable or Metastatic Malignant Solid Tumors With Positive Expression of Claudin 18.2, NCT05205850
Ref 2 Phase 1, First-in-Human, Multicentre, Open-label Study of RC118 for Injection in Patients With Locally Advanced Unresectable/Metastatic Solid Tumours, NCT04914117
Ref 3 Phase I Study of AVID200 in Patients With Myelofibrosis (Myeloproliferative Neoplasms Research Consortium [MPN-RC] 118), NCT03895112