General Information of This Antigen (ID: TAR0HWXDI)
Antigen Name
B-lymphocyte antigen CD19 (CD19); T-cell surface glycoprotein CD3 delta chain (CD3D)
Gene Name
CD19; CD3D
Gene ID
930 , 915
Synonym1
B-lymphocyte surface antigen B4; Differentiation antigen CD19; T-cell surface antigen Leu-12; CD19
Synonym2
T3D; T-cell receptor T3 delta chain; CD3d
Sequence1
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW
VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG
LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF
YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS
PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP
DPAWGGGGRMGTWSTR

    Click to Show/Hide
Sequence2
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDL
GKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLAL
GVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK

    Click to Show/Hide
Function1
Functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes. Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens. Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores. Is not required for early steps during B cell differentiation in the blood marrow. Required for normal differentiation of B-1 cells. Required for normal B cell differentiation and proliferation in response to antigen challenges. Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge.

    Click to Show/Hide
Function2
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR- mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3D plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells().

    Click to Show/Hide
Uniprot Entry
CD19_HUMAN , CD3D_HUMAN
HGNC ID
HGNC:1633 , HGNC:1673
KEGG ID
hsa:930 , hsa:915
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens
Blinatumomab
ADC Name Payload Target Linker ADC Info
Blinatumomab-2i [1]
Monomethyl auristatin F
Microtubule (MT)
Blinatumomab-2i linker
Blinatumomab-4i [1]
Monomethyl auristatin F
Microtubule (MT)
Blinatumomab-4i linker
Blinatumomab-3i [1]
Monomethyl auristatin F
Microtubule (MT)
Blinatumomab-3i linker
Blinatumomab-6e [1]
Monomethyl auristatin E
Microtubule (MT)
Blinatumomab-6e linker
Blinatumomab-amanitin [1]
Alpha-amanitin
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G)
Blinatumomab-amanitin linker
Blinatumomab-Compound 9 [2]
Mertansine DM1
Microtubule (MT)
Blinatumomab-Compound 9 linker
Blinatumomab-Compound 17 [2]
Mertansine DM4
Microtubule (MT)
Blinatumomab-Compound 17 linker
Blinatumomab-Compound 25 [2]
Monomethyl auristatin E
Microtubule (MT)
Blinatumomab-Compound 25 linker
Blinatumomab-Compound 31 [2]
Auristatin 0101
Microtubule (MT)
Blinatumomab-Compound 31 linker
Blinatumomab-Compound 36 [2]
Monomethyl auristatin E
Microtubule (MT)
Blinatumomab-Compound 36 linker
Blinatumomab-Compound 43 [2]
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Blinatumomab-Compound 43 linker
Blinatumomab-Compound 49 [2]
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Blinatumomab-Compound 49 linker
Blinatumomab-Compound 55 [2]
Mertansine DM1
Microtubule (MT)
Blinatumomab-Compound 55 linker
Blinatumomab-Compound 59 [2]
Mertansine DM4
Microtubule (MT)
Blinatumomab-Compound 59 linker
Blinatumomab-Compound 64 [2]
Monomethyl auristatin E
Microtubule (MT)
Blinatumomab-Compound 64 linker
Blinatumomab-Compound 69 [2]
Monomethyl auristatin E
Microtubule (MT)
Blinatumomab-Compound 69 linker
Blinatumomab-Compound 74 [2]
PBD dimer
Human Deoxyribonucleic acid (hDNA)
Blinatumomab-Compound 74 linker
Blinatumomab-Compound 75 [2]
Monomethyl auristatin E
Microtubule (MT)
Blinatumomab-Compound 75 linker
Blinatumomab-Compound 76 [2]
Monomethyl auristatin E
Microtubule (MT)
Blinatumomab-Compound 76 linker
Blinatumomab-Compound 77 [2]
Mertansine DM1
Microtubule (MT)
Blinatumomab-Compound 77 linker
Blinatumomab-Compound 78 [2]
Auristatin 0101
Microtubule (MT)
Blinatumomab-Compound 78 linker
Blinatumomab-Compound 79 [2]
Auristatin 0101
Microtubule (MT)
Blinatumomab-Compound 79 linker
Blinatumomab-Compound 80 [2]
Mertansine DM4
Microtubule (MT)
Blinatumomab-Compound 80 linker
References
Ref 1 Compositions and methods related to anti-cd19 antibody drug conjugates; 2017-03-30.
Ref 2 Covalent linkers in antibody-drug conjugates and methods of making and using the same.