Antigen Information
General Information of This Antigen
| Antigen ID | TAR0HWXDI |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | B-lymphocyte antigen CD19 (CD19); T-cell surface glycoprotein CD3 delta chain (CD3D) |
|||||
| Gene Name | CD19; CD3D |
|||||
| Gene ID | ||||||
| Synonym1 | B-lymphocyte surface antigen B4; Differentiation antigen CD19; T-cell surface antigen Leu-12; CD_antigen=CD19 |
|||||
| Synonym2 | T3D; T-cell receptor T3 delta chain; CD_antigen=CD3d |
|||||
| Sequence1 |
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP DPAWGGGGRMGTWSTR Click to Show/Hide
|
|||||
| Sequence2 |
MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDL
GKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLAL GVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK Click to Show/Hide
|
|||||
| Function1 |
Functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes. Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens. Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores. Is not required for early steps during B cell differentiation in the blood marrow. Required for normal differentiation of B-1 cells. Required for normal B cell differentiation and proliferation in response to antigen challenges. Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge.
Click to Show/Hide
|
|||||
| Function2 |
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR- mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3D plays an essential role in thymocyte differentiation. Indeed, participates in correct intracellular TCR-CD3 complex assembly and surface expression. In absence of a functional TCR-CD3 complex, thymocytes are unable to differentiate properly. Interacts with CD4 and CD8 and thus serves to establish a functional link between the TCR and coreceptors CD4 and CD8, which is needed for activation and positive selection of CD4 or CD8 T-cells().
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Blinatumomab
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Blinatumomab-2i |
Monomethyl auristatin F |
Microtubule (MT) |
Blinatumomab-2i linker |
[1] | |
Blinatumomab-4i |
Monomethyl auristatin F |
Microtubule (MT) |
Blinatumomab-4i linker |
[1] | |
Blinatumomab-3i |
Monomethyl auristatin F |
Microtubule (MT) |
Blinatumomab-3i linker |
[1] | |
Blinatumomab-6e |
Monomethyl auristatin E |
Microtubule (MT) |
Blinatumomab-6e linker |
[1] | |
Blinatumomab-amanitin |
Alpha-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
Blinatumomab-amanitin linker |
[1] | |
Blinatumomab-Compound 9 |
Mertansine DM1 |
Microtubule (MT) |
Blinatumomab-Compound 9 linker |
[2] | |
Blinatumomab-Compound 17 |
Mertansine DM4 |
Microtubule (MT) |
Blinatumomab-Compound 17 linker |
[2] | |
Blinatumomab-Compound 25 |
Monomethyl auristatin E |
Microtubule (MT) |
Blinatumomab-Compound 25 linker |
[2] | |
Blinatumomab-Compound 31 |
Auristatin 0101 |
Microtubule (MT) |
Blinatumomab-Compound 31 linker |
[2] | |
Blinatumomab-Compound 36 |
Monomethyl auristatin E |
Microtubule (MT) |
Blinatumomab-Compound 36 linker |
[2] | |
Blinatumomab-Compound 43 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Blinatumomab-Compound 43 linker |
[2] | |
Blinatumomab-Compound 49 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Blinatumomab-Compound 49 linker |
[2] | |
Blinatumomab-Compound 55 |
Mertansine DM1 |
Microtubule (MT) |
Blinatumomab-Compound 55 linker |
[2] | |
Blinatumomab-Compound 59 |
Mertansine DM4 |
Microtubule (MT) |
Blinatumomab-Compound 59 linker |
[2] | |
Blinatumomab-Compound 64 |
Monomethyl auristatin E |
Microtubule (MT) |
Blinatumomab-Compound 64 linker |
[2] | |
Blinatumomab-Compound 69 |
Monomethyl auristatin E |
Microtubule (MT) |
Blinatumomab-Compound 69 linker |
[2] | |
Blinatumomab-Compound 74 |
PBD dimer |
Human Deoxyribonucleic acid (hDNA) |
Blinatumomab-Compound 74 linker |
[2] | |
Blinatumomab-Compound 75 |
Monomethyl auristatin E |
Microtubule (MT) |
Blinatumomab-Compound 75 linker |
[2] | |
Blinatumomab-Compound 76 |
Monomethyl auristatin E |
Microtubule (MT) |
Blinatumomab-Compound 76 linker |
[2] | |
Blinatumomab-Compound 77 |
Mertansine DM1 |
Microtubule (MT) |
Blinatumomab-Compound 77 linker |
[2] | |
Blinatumomab-Compound 78 |
Auristatin 0101 |
Microtubule (MT) |
Blinatumomab-Compound 78 linker |
[2] | |
Blinatumomab-Compound 79 |
Auristatin 0101 |
Microtubule (MT) |
Blinatumomab-Compound 79 linker |
[2] | |
Blinatumomab-Compound 80 |
Mertansine DM4 |
Microtubule (MT) |
Blinatumomab-Compound 80 linker |
[2] |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
