Antigen Information
General Information of This Antigen (ID: TAR0GZXLR)
| Antigen Name | Epithelial cell adhesion molecule (EPCAM) |
|||||
|---|---|---|---|---|---|---|
| Gene Name | EPCAM |
|||||
| Gene ID | ||||||
| Synonym | GA733-2; M1S2; M4S1; MIC18; TACSTD1; TROP1; Adenocarcinoma-associated antigen;Cell surface glycoprotein Trop-1;Epithelial cell surface antigen;Epithelial glycoprotein;Epithelial glycoprotein 314;KS 1/4 antigen;KSA;Major gastrointestinal tumor-associated protein GA733-2;Tumor-associated calcium signal transducer 1;CD326 |
|||||
| Sequence |
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS
KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA EIKEMGEMHRELNA Click to Show/Hide
|
|||||
| Family | CTL (choline transporter-like) family |
|||||
| Function |
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjugate and Its Component Related to This Antigen
Full List of The ADC Related to This Antigen
| The Numbers of ADCs, Their Three Components, Payload Targets, and Corresponding Diseases for This Antigens | ||||
|---|---|---|---|---|
huHEA125
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
huHEA125-amanitin1
[1]
|
Beta-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-Amanitin1 linker |
|
|
huHEA125-alpha-amanitin conjugate 3
[1]
|
Alpha-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-alpha-amanitin conjugate 3 linker |
|
|
huHEA125-alpha-amanitin conjugate 4
[1]
|
Alpha-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-alpha-amanitin conjugate 4 linker |
|
|
huHEA125-alpha-amanitin conjugate 7
[1]
|
Alpha-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-alpha-amanitin conjugate 7 linker |
|
|
huHEA125-alpha-amanitin conjugate 10
[1]
|
Alpha-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-alpha-amanitin conjugate 10 linker |
|
|
huHEA125-alpha-amanitin conjugate 11
[1]
|
Alpha-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-alpha-amanitin conjugate 11 linker |
|
|
huHEA125-alpha-amanitin conjugate 14
[1]
|
Alpha-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-alpha-amanitin conjugate 14 linker |
|
|
huHEA125-alpha-amanitin conjugate 15
[1]
|
Alpha-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-alpha-amanitin conjugate 15 linker |
|
|
huHEA125-amanitin3
[1]
|
Beta-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-Amanitin3 linker |
|
|
huHEA125-amanitin4
[1]
|
Beta-amanitin |
DNA-directed RNA polymerase II subunit RPB2 (POLR2B); DNA-directed RNA polymerase III subunit RPC7 (POLR3G) |
huHEA125-Amanitin4 linker |
Oportuzumab
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
VB4-845
|
Pseudomonas exotoxin ETA-252-608 |
Undisclosed |
Undisclosed |
Varsetatug
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
Varsetatug masetecan
|
CAMP59 |
DNA topoisomerase 1 (TOP1) |
L-ala-ala-ala (TAL) |
Undisclosed
| ADC Name | Payload | Target | Linker | ADC Info |
|---|---|---|---|---|
|
BA-3181
[2]
|
Undisclosed |
Undisclosed |
Undisclosed |
|
|
Oportuzumab monatox (Eleven Bio)
[3]
|
Undisclosed |
Undisclosed |
Undisclosed |
References