Antibody Information
General Information of This Antibody
| Antibody ID | ANI0OLLNW |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | huHEA125 |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Chimeric IgG1-kappa |
|||||
| Antigen Name | Epithelial cell adhesion molecule (EPCAM) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVKLLESGGGLVQPGGSLKLSCAASGFDFSRFWMTWVRQAPGKGLEWIGEINLDSSTINY
TPSLKDKFIISRDNAKNTLFLQMSKVRSEDTALYYCSRGISMDYWGQGTSVTVSSASTKG PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQ VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGLQLDETCAEAQDGELDGLWTTITIFISLFLLSVCYS AAVTLFKVKWIFSSVVELKQTLVPEYKNMIGQAP Click to Show/Hide
|
|||||
| Light Chain Sequence |
DILLTQSPAILSVSPGERVSFSCRASQSIGISLHWYQQRPSDSPRLLIKYASESISGIPS
RFSGSGSGTDFTLSINSVESEDIADYYCQQSNIWPTTFGAGTKLELKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
huHEA125-amanitin3 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1-40 pM
|
Positive EPCAM expression (EPCAM+++/++) | ||
| Method Description |
Cells were added in 50 ul at a density of 50,000 per ml in the experiments with ADCs and at a density of 20,000 per ml in the experiments with huHEA125-Amanitin3. Plates were incubated in a humidified atmosphere at 37°C and 5% CO2 for 72 or 96 h. At 20 h before the end of the assay, 1 uCi of H-thymidine was added.
|
||||
| In Vitro Model | Colon adenocarcinoma | COLO 205 cells | CVCL_0218 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
2.00 pM
|
Positive EPCAM expression (EPCAM+++/++) | ||
| Method Description |
Cells were added in 50 ul at a density of 50,000 per ml in the experiments with ADCs and at a density of 20,000 per ml in the experiments with huHEA125-Amanitin3. Plates were incubated in a humidified atmosphere at 37°C and 5% CO2 for 72 or 96 h. At 20 h before the end of the assay, 1 uCi of H-thymidine was added.
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.01-0.3 nM
|
Positive EPCAM expression (EPCAM+++/++) | ||
| Method Description |
Cells were added in 50 ul at a density of 50,000 per ml in the experiments with ADCs and at a density of 20,000 per ml in the experiments with huHEA125-Amanitin3. Plates were incubated in a humidified atmosphere at 37°C and 5% CO2 for 72 or 96 h. At 20 h before the end of the assay, 1 uCi of H-thymidine was added.
|
||||
| In Vitro Model | Pancreatic ductal adenocarcinoma | Capan-1 cells | CVCL_0237 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.01-0.6 nM
|
Positive EPCAM expression (EPCAM+++/++) | ||
| Method Description |
Cells were added in 50 ul at a density of 50,000 per ml in the experiments with ADCs and at a density of 20,000 per ml in the experiments with huHEA125-Amanitin3. Plates were incubated in a humidified atmosphere at 37°C and 5% CO2 for 72 or 96 h. At 20 h before the end of the assay, 1 uCi of H-thymidine was added.
|
||||
| In Vitro Model | Cholangiocarcinoma | OZ cells | CVCL_3118 | ||
huHEA125-amanitin1 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
5.00 pM
|
Positive EPCAM expression (EPCAM+++/++) | ||
| Method Description |
Cells were added in 50 ul at a density of 50,000 per ml in the experiments with ADCs and at a density of 20,000 per ml in the experiments with huHEA125-Amanitin3. Plates were incubated in a humidified atmosphere at 37°C and 5% CO2 for 72 or 96 h. At 20 h before the end of the assay, 1 uCi of H-thymidine was added.
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
huHEA125-amanitin4 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
5.00 pM
|
Positive EPCAM expression (EPCAM+++/++) | ||
| Method Description |
Cells were added in 50 ul at a density of 50,000 per ml in the experiments with ADCs and at a density of 20,000 per ml in the experiments with huHEA125-Amanitin3. Plates were incubated in a humidified atmosphere at 37°C and 5% CO2 for 72 or 96 h. At 20 h before the end of the assay, 1 uCi of H-thymidine was added.
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.