Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0ZYKEU |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | mAb001 |
|||||
| Organization | VISTERRA, INC. |
|||||
| Synonyms |
mAb001
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG |
|||||
| Antigen Name | Lipopolysaccharide O antigen (LPS O antigen) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
GAAGTGAAGTTGGTGGAGTCTGGGGGAGACTTGGTGAAACCTGGAGGGTCCCTGAGACTC
TCCTGTGCAGCCTCTGAATTCACTTTCAGTGATTATGCCATGTCTTGGGTTCGCCAGACT CCGGCGAAGAGGCTGGAGTGGGTCGCATACATTAGTAGTGATGGTGATAGTACCTACTAT CCGGACAATATTAAGGGCCGATTCACCATCTCCAGAGACAATGCCAAGAACACCCTATAC CTGCAAATGAACAGTCTGAGGTCTGAGGACACGGCCATGTATTTTTGTGCAAGAGAAATA CGGCTAAGGGGGTACTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCA Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
EVKLVESGGDLVKPGGSLRLSCAASEFTFSDYAMSWVRQTPAKRLEWVAYISSDGDSTYY
PDNIKGRFTISRDNAKNTLYLQMNSLRSEDTAMYFCAREIRLRGYFDVWGAGTTVTVSS Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
EFTFSDY
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
SSDGDS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
EIRLRGYFDV
Click to Show/Hide
|
|||||
| Light Chain Sequence |
GACATTGTGCTGACCCAATCTCCAGCTTCTTTGGCTGTGTCTCTAGGGCAGAGGGCCACC
ATATCCTGCAGAGCCAGTGAAAGTGTTTTTGGTCATGGCATTAGTCCTATGCACTGGTAC CAGCAGAAACCAGGACAGCCACCCAAACTCCTCATCTATCGTGCATCCAACCTAAAATTT GGGATCCCTGCCAGGTTCAGTGGCAGTGGGTCTAGGACAGACTTCACCCTCACCATTAAT CCTGTGGAGGCTGATGATGTTGCAACCTATTACTGTCAGCAAAGTAATGAATATCCTCGG ACGTTCGGTGGAGGCACCAAGCTGGAGATCAAA Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DIVLTQSPASLAVSLGQRATISCRASESVFGHGISPMHWYQQKPGQPPKLLIYRASNLKF
GIPARFSGSGSRTDFTLTINPVEADDVATYYCQQSNEYPRTFGGGTKLEIK Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
RASESVFGHGISPMH
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
RASNLKF
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
QQSNEYPRT
Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
Half Maximal inhibitory Concentration (lC50)
|
>100 |
ug/ml
|
U266 (CD38-) cells | . | ||
|---|---|---|---|---|---|---|
| Antibody Function | mAb001 bound to Pae27853 | |||||
| Antibody Antigen Binding Assay | Conjugates were tested in Pae27853, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight. | |||||
| Antibody Activity Information 2 | [1] | |||||
|
Half Maximal inhibitory Concentration (lC50)
|
>100 |
ug/ml
|
U266 (CD38-) cells | . | ||
| Antibody Function | mAb001 bound to BAA-2110 | |||||
| Antibody Antigen Binding Assay | Conjugates were tested in BAA-2110, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight. | |||||
| Antibody Activity Information 3 | [1] | |||||
|
Half Maximal inhibitory Concentration (lC50)
|
>100 |
ug/ml
|
U266 (CD38-) cells | . | ||
| Antibody Function | mAb001 bound to BAA-2114 | |||||
| Antibody Antigen Binding Assay | Conjugates were tested in BAA-2114, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight. | |||||
| Antibody Activity Information 4 | [1] | |||||
|
Half Maximal inhibitory Concentration (lC50)
|
>100 |
ug/ml
|
U266 (CD38-) cells | . | ||
| Antibody Function | mAb001 bound to BAA-2108 | |||||
| Antibody Antigen Binding Assay | Conjugates were tested in BAA-2108, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
ES2994374T3 conjugate5 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.4 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae39324, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae39324 | . | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
1.6 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae27853, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae27853 | . | ||
ES2994374T3 conjugate4 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.8 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae39324, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae39324 | . | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
6.3 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae27853, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae27853 | . | ||
ES2994374T3 conjugate3 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
3.1 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae39324, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae39324 | . | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
6.3 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae27853, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae27853 | . | ||
mAb001-Conjugate2 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
3.1 ug/ml
|
|||
| Method Description |
Conjugates were tested in BAA-2114, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | Pseudomonas aeruginosa (Schroeter) Migula | BAA-2114 | Pseudomonas aeruginosa (Schroeter) Migula | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
3.1 ug/ml
|
|||
| Method Description |
Conjugates were tested in BAA-2108, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | Pseudomonas aeruginosa (Schroeter) Migula | BAA-2108 | Pseudomonas aeruginosa (Schroeter) Migula | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
3.3 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae27853, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae27853 | . | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
6.3 ug/ml
|
|||
| Method Description |
Conjugates were tested in BAA-2110, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | Pseudomonas aeruginosa (Schroeter) Migula | BAA-2110 | Pseudomonas aeruginosa (Schroeter) Migula | ||
ES2994374T3 conjugate1 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
6.3 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae39324, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae39324 | . | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
25 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae27853, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae27853 | . | ||
mAb001-Conjugate1 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
6.3 ug/ml
|
|||
| Method Description |
Conjugates were tested in BAA-2114, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | Pseudomonas aeruginosa (Schroeter) Migula | BAA-2114 | Pseudomonas aeruginosa (Schroeter) Migula | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
6.3 ug/ml
|
|||
| Method Description |
Conjugates were tested in BAA-2108, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | Pseudomonas aeruginosa (Schroeter) Migula | BAA-2108 | Pseudomonas aeruginosa (Schroeter) Migula | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
12.5 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae27853, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae27853 | . | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
12.5 ug/ml
|
|||
| Method Description |
Conjugates were tested in BAA-2110, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | Pseudomonas aeruginosa (Schroeter) Migula | BAA-2110 | Pseudomonas aeruginosa (Schroeter) Migula | ||
ES2994374T3 conjugate2 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
12.5 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae39324, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae39324 | . | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
25 ug/ml
|
|||
| Method Description |
Conjugates were tested in Pae27853, diluted and loaded into a 96 well polypropylene microtiter plate. Then the microtiter plate was incubated at 37°C overnight.
|
||||
| In Vitro Model | P. aeruginosa strains | Pae27853 | . | ||