Antibody ID	ANTI0ZGRTK
Antibody Name	TPP-2658
Organization	VINCERX PHARMA GMBH
Synonyms	TPP-2658    Click to Show/Hide
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized lgG
Antigen Name	Tumor necrosis factor receptor superfamily member 12A (TNFRSF12A)					Antigen Info
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	EVQLLESGGGLVQPGGSLRLSCAASGFTFSPYPMIWVRQAPGKGLEWVSYISPSGGSTHY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGDTYFDYFDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYA STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG     Click to Show/Hide
Heavy Chain Varible Domain	EVQLLESGGGLVQPGGSLRLSCAASGFTFSPYPMIWVRQAPGKGLEWVSYISPSGGSTHY ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGGDTYFDYFDYWGQGTLVTVSS A     Click to Show/Hide
Heavy Chain CDR 1	PYPMI     Click to Show/Hide
Heavy Chain CDR 2	YISPSGGSTHYADSVKG     Click to Show/Hide
Heavy Chain CDR 3	GGDTYFDYFDY     Click to Show/Hide
Light Chain Sequence	DIQMTQSPSSLSASVGDRVTITCRASQSISGYLNWYQQKPGKAPKLLIYQASSLQSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTSPFITFGQGTKVEIKRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC     Click to Show/Hide
Light Chain Varible Domain	DIQMTQSPSSLSASVGDRVTITCRASQSISGYLNWYQQKPGKAPKLLIYQASSLQSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTSPFITFGQGTKVEIK     Click to Show/Hide
Light Chain CDR 1	RASQSISGYLN     Click to Show/Hide
Light Chain CDR 2	QASSLQS     Click to Show/Hide
Light Chain CDR 3	QQSYTSPFIT     Click to Show/Hide

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 6 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 6 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	13&#459.9 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 10 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 10 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	103&#4599 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Colon cancer	HT29 cells		CVCL_A8EZ
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1003&#45999 nM
Method Description	The cells were cultivated according to the standard method using the growth media suggest by provider The test was carried out by detaching the cells with a solution of Accutase in PBS buffer (fromBiochrom AG #L2143).
In Vitro Model	Renal cell carcinoma	786-O cells		CVCL_1051
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 8 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 8 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.0165 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.458 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.603 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.083 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Breast inflammatory carcinoma	KPL4 cells		CVCL_5310
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.348 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Liver and intrahepatic bile duct epithelial neoplasm	SK-HEP-1 cells		CVCL_0525
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.986 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.109 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.256 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.391 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.122 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.836 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.98 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.123 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.332 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.59 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.143 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.08 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.11 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.152 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.719 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.09 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.166 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.816 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.43 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.17 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.796 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	5.94 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.182 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.29 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.577 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.204 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.584 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.94 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.206 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.23 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.04 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.212 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.16 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.75 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.213 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.256 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.683 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.228 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.684 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	5.08 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.231 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.909 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.4 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.236 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.42 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.09 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.245 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.04 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	3.29 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.285 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.845 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.16 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.286 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	16.5 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	22.9 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.306 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	13.2 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	16.9 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.313 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.566 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.806 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.346 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.534 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.861 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.433 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.618 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.17 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.445 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.37 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	9.04 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.467 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.04 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	13 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.524 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	22.6 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	23.3 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.563 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.61 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.11 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.682 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.694 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	6.7 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.736 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.06 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.15 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	0.878 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	4.65 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	9.95 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.27 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.34 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	15.6 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.34 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Liver and intrahepatic bile duct epithelial neoplasm	SK-HEP-1 cells		CVCL_0525
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	3.07 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.37 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.96 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	> 600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.46 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	80.7 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	> 600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.5 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.92 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Liver and intrahepatic bile duct epithelial neoplasm	SK-HEP-1 cells		CVCL_0525

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.69 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	6 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.72 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.99 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	241 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	1.99 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.54 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	> 600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.09 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	2.12 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Liver and intrahepatic bile duct epithelial neoplasm	SK-HEP-1 cells		CVCL_0525

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	4.2 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	4.31 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	> 600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	4.71 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	> 600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	> 600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	4.77 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	10.9 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	> 600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	6.52 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Pancreatic ductal adenocarcinoma	BxPC-3 cells		CVCL_0186
Experiment 2 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	> 600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Lung mucoepidermoid carcinoma	NCI-H292 cells		CVCL_0455
Experiment 3 Reporting the Activity Date of This ADC					[2]
Efficacy Data	Half Maximal inhibitory Concentration (IC50)Human PBMC	> 600 nM	Positive TNFRSF12A expression (TNFRSF12A+++/++)
Method Description	Tables 1b and 1c below set out the IC50 values for representative working examples from this assay
In Vitro Model	Colon adenocarcinoma	LoVo cells		CVCL_0399

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 7 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (-NE)		CVCL_1600
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (NCI H292: 2500 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 7 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Plasma cell myeloma, Multiple myeloma	NCI-H929 cells (+NE)		CVCL_1600
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 7 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (+NE)		CVCL_3422
Experiment 5 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 12 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 6 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (SUM149PT 2000 cells/well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 7 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Breast inflammatory carcinoma	SUM149PT cells (-NE)		CVCL_3422

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 14 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 14 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	1.0- 9.9 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 16 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 16 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone and was added followed by a 96 h incubation in an incubator at 37°C and 18 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (-NE)		CVCL_1051
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Activity Concentration at -50% (AC50)	10- 99 nM
Method Description	After cell counting a defined cell number was sowed into a 96-well culture plate with white bottom (from Costar #3610) (786-0: 1500 cells/ well) in total volume 100 uL. The cells (except MOLM-13 cells, these cells were directly treated) were then incubated in an incubator at 37°C and 5 % carbon dioxide. After 48 h, the medium was replaced. The treatment started by adding the test compounds in 10 uL of culture medium to the cells in triplicates. Concentrations ranging from 10-5 M to 10-13 M were chosen. Two identical treated sets of samples were prepared. One set was treated with the test compound alone, whereas to the second set the test compound and 5nM hum.neutrophil elastase were added followed by a 96 h incubation in an incubator at 37°C and 18 % carbon dioxide.    Click to Show/Hide
In Vitro Model	Renal cell carcinoma	786-O cells (+NE)		CVCL_1051

Ref 1	Antibody-drug conjugates cleavable in a tumor microenvironment
Ref 2	Antibody drug conjugates with enzymatically cleavable groups