General Information of This Antigen
Antigen ID
TAR0DBBHK
Antigen Name
Tumor necrosis factor receptor superfamily member 12A (TNFRSF12A)
Gene Name
TNFRSF12A
Gene ID
51330
Synonym
FN14; Fibroblast growth factor-inducible immediate-early response protein 14;Tweak-receptor;CD_antigen=CD266
Sequence
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH
SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE
GCPAVALIQ

    Click to Show/Hide
Function
Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.

    Click to Show/Hide
Uniprot Entry
TNR12_HUMAN
HGNC ID
HGNC:18152
KEGG ID
hsa:51330
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-TWEAKR mAb
ADC Info ADC Name Payload Target Linker Ref
TWEAKR-KSP-ADC 1.1
Pyrrole based kinesin spindle protein inhibitor
Kinesin-like protein KIF11 (KIF11)
Kinesin spindle protein inhibitor (KSPi)-ADC linker 1
[1]
TWEAKR-KSP-ADC 1.2
Pyrrole based kinesin spindle protein inhibitor
Kinesin-like protein KIF11 (KIF11)
Kinesin spindle protein inhibitor (KSPi)-ADC linker 2
[1]
TWEAKR-KSP-ADC 1.3
Pyrrole based kinesin spindle protein inhibitor
Kinesin-like protein KIF11 (KIF11)
Kinesin spindle protein inhibitor (KSPi)-ADC linker 3
[1]
TWEAKR-KSP-ADC 1.4
Pyrrole based kinesin spindle protein inhibitor
Kinesin-like protein KIF11 (KIF11)
Kinesin spindle protein inhibitor (KSPi)-ADC linker 4
[1]
TWEAKR-KSP-ADC 2.1
Pyrrole based kinesin spindle protein inhibitor
Kinesin-like protein KIF11 (KIF11)
Kinesin spindle protein inhibitor (KSPi)-ADC linker 5
[1]
TWEAKR-KSP-ADC 2.2
Pyrrole based kinesin spindle protein inhibitor
Kinesin-like protein KIF11 (KIF11)
Kinesin spindle protein inhibitor (KSPi)-ADC linker 6
[1]
Anti?TWEAKR mAb
ADC Info ADC Name Payload Target Linker Ref
CN114917361A ADC-10
CN114917361A ADC-10 payload
Undisclosed
CN114917361A ADC-10 linker
[2]
CN114917361A ADC-12
CN114917361A ADC-12 payload
Undisclosed
CN114917361A ADC-12 linker
[2]
CN114917361A ADC-15
CN114917361A ADC-15 payload
Undisclosed
CN114917361A ADC-15 linker
[2]
CN114917361A ADC-18
CN114917361A ADC-18 payload
Undisclosed
CN114917361A ADC-18 linker
[2]
CN114917361A ADC-20
CN114917361A ADC-20 payload
Undisclosed
CN114917361A ADC-20 linker
[2]
CN114917361A ADC-23
CN114917361A ADC-23 payload
Undisclosed
CN114917361A ADC-23 linker
[2]
CN114917361A ADC-24
CN114917361A ADC-24 payload
Undisclosed
CN114917361A ADC-24 linker
[2]
CN114917361A ADC-26
CN114917361A ADC-26 payload
Undisclosed
CN114917361A ADC-26 linker
[2]
CN114917361A ADC-29
CN114917361A ADC-29 payload
Undisclosed
CN114917361A ADC-29 linker
[2]
CN114917361A ADC-32
CN114917361A ADC-32 payload
Undisclosed
CN114917361A ADC-32 linker
[2]
CN114917361A ADC-35
CN114917361A ADC-35 payload
Undisclosed
CN114917361A ADC-35 linker
[2]
CN114917361A ADC-38
CN114917361A ADC-38 payload
Undisclosed
CN114917361A ADC-38 linker
[2]
CN114917361A ADC-4
CN114917361A ADC-4 payload
Undisclosed
CN114917361A ADC-4 linker
[2]
CN114917361A ADC-40
CN114917361A ADC-40 payload
Undisclosed
CN114917361A ADC-40 linker
[2]
CN114917361A ADC-43
CN114917361A ADC-43 payload
Undisclosed
CN114917361A ADC-43 linker
[2]
CN114917361A ADC-46
CN114917361A ADC-46 payload
Undisclosed
CN114917361A ADC-46 linker
[2]
CN114917361A ADC-49
CN114917361A ADC-49 payload
Undisclosed
CN114917361A ADC-49 linker
[2]
CN114917361A ADC-5
CN114917361A ADC-5 payload
Undisclosed
CN114917361A ADC-5 linker
[2]
CN114917361A ADC-52
CN114917361A ADC-52 payload
Undisclosed
CN114917361A ADC-52 linker
[2]
CN114917361A ADC-53
CN114917361A ADC-53 payload
Undisclosed
CN114917361A ADC-53 linker
[2]
CN114917361A ADC-54
CN114917361A ADC-54 payload
Undisclosed
CN114917361A ADC-54 linker
[2]
CN114917361A ADC-57
CN114917361A ADC-57 payload
Undisclosed
CN114917361A ADC-57 linker
[2]
CN114917361A ADC-60
CN114917361A ADC-60 payload
Undisclosed
CN114917361A ADC-60 linker
[2]
CN114917361A ADC-63
CN114917361A ADC-63 payload
Undisclosed
CN114917361A ADC-63 linker
[2]
CN114917361A ADC-66
CN114917361A ADC-66 payload
Undisclosed
CN114917361A ADC-66 linker
[2]
CN114917361A ADC-69
CN114917361A ADC-69 payload
Undisclosed
CN114917361A ADC-69 linker
[2]
CN114917361A ADC-72
CN114917361A ADC-72 payload
Undisclosed
CN114917361A ADC-72 linker
[2]
CN114917361A ADC-75
CN114917361A ADC-75 payload
Undisclosed
CN114917361A ADC-75 linker
[2]
CN114917361A ADC-78
CN114917361A ADC-78 payload
Undisclosed
CN114917361A ADC-78 linker
[2]
CN114917361A ADC-8
CN114917361A ADC-8 payload
Undisclosed
CN114917361A ADC-8 linker
[2]
CN114917361A ADC-81
CN114917361A ADC-81 payload
Undisclosed
CN114917361A ADC-81 linker
[2]
CN114917361A ADC-84
CN114917361A ADC-84 payload
Undisclosed
CN114917361A ADC-84 linker
[2]
CN114917361A ADC-9
CN114917361A ADC-9 payload
Undisclosed
CN114917361A ADC-9 linker
[2]
ADC Info ADC Name Payload Target Linker Ref
TWEAKR ADC 3a
Kinesin spindle protein (KSP) inhibitor 3a
Kinesin-like protein KIF11 (KIF11)
Open-chain glycine maleimide
[3]
TWEAKR ADC 3b
Kinesin spindle protein (KSP) inhibitor 3b
Kinesin-like protein KIF11 (KIF11)
Open-chain glycine maleimide
[3]
TWEAKR ADC 3c
Kinesin spindle protein (KSP) inhibitor 3c
Kinesin-like protein KIF11 (KIF11)
Open-chain glycine maleimide
[3]
TWEAKR ADC 3d
Kinesin spindle protein (KSP) inhibitor 3d
Kinesin-like protein KIF11 (KIF11)
Open-chain glycine maleimide
[3]
TWEAKR ADC 3e
Kinesin spindle protein (KSP) inhibitor 3e
Kinesin-like protein KIF11 (KIF11)
Open-chain glycine maleimide
[3]
TWEAKR ADC 3f
Kinesin spindle protein (KSP) inhibitor 3f
Kinesin-like protein KIF11 (KIF11)
Open-chain glycine maleimide
[3]
TWEAKR ADC 3g
Kinesin spindle protein (KSP) inhibitor 3g
Kinesin-like protein KIF11 (KIF11)
Open-chain glycine maleimide
[3]
TWEAKR-KSPi-ADC1
KSP inhibitor
Kinesin-like protein KIF11 (KIF11)
Glutaricacid-peptide-based linker
[4]
TWEAKR-KSPi-ADC2
KSP inhibitor
Kinesin-like protein KIF11 (KIF11)
Mc-peptide-based linker
[4]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.081410407; Fold-change: 0.145971009; Z-score: 0.260586525
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.519416405; Fold-change: 0.178530975; Z-score: 0.584893757
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000395516; Fold-change: 1.609417932; Z-score: 1.78250366
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.163193418; Fold-change: 0.085378547; Z-score: 0.303460785
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.05E-43; Fold-change: 0.579606752; Z-score: 1.180543433
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.25E-10; Fold-change: 0.32975321; Z-score: 1.51517166
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.022879508; Fold-change: 0.146612451; Z-score: 0.686314935
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.03769113; Fold-change: -0.185605395; Z-score: -0.478464848
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.326785775; Fold-change: 0.01380786; Z-score: 0.049703479
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.212802423; Fold-change: -0.184324576; Z-score: -1.366995136
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.154759377; Fold-change: 1.290440513; Z-score: 1.433455055
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.00145845; Fold-change: 0.993056779; Z-score: 1.26579444
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.81E-44; Fold-change: 0.953641013; Z-score: 1.569285554
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 4.53E-43; Fold-change: 0.977859301; Z-score: 1.909040164
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001118367; Fold-change: 0.704041773; Z-score: 1.057020726
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002966519; Fold-change: 0.418013961; Z-score: 0.522688753
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003863603; Fold-change: 0.269799763; Z-score: 0.456665489
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.051663956; Fold-change: -0.1041222; Z-score: -0.162887107
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.842396999; Fold-change: -0.127449168; Z-score: -0.162628439
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.01E-06; Fold-change: 0.348748787; Z-score: 0.489831317
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.168340431; Fold-change: 0.222256243; Z-score: 0.260056981
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.588370766; Fold-change: 0.658229679; Z-score: 0.434742146
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.53E-12; Fold-change: 0.384573226; Z-score: 0.488945575
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.081445318; Fold-change: 0.187859029; Z-score: 0.472695452
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.70E-33; Fold-change: 0.975705924; Z-score: 1.15598958
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.05E-05; Fold-change: 0.481169288; Z-score: 0.60779673
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004264962; Fold-change: 1.274145734; Z-score: 1.402481601
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.478552693; Fold-change: 0.366357211; Z-score: 0.215243761
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008215515; Fold-change: 0.511530402; Z-score: 0.849373524
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000172508; Fold-change: 0.553565663; Z-score: 0.522458683
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.002504759; Fold-change: -1.75442709; Z-score: -3.038402327
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.056962017; Fold-change: -0.592313343; Z-score: -0.492950396
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 9.80E-16; Fold-change: 1.423727265; Z-score: 8.111978853
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.741824456; Fold-change: 0.264128132; Z-score: 0.47175174
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.21E-41; Fold-change: 2.267443697; Z-score: 2.489504051
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.52E-15; Fold-change: 2.820592423; Z-score: 2.432161283
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.001023646; Fold-change: 0.168319894; Z-score: 0.427106602
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.12E-58; Fold-change: 1.562134119; Z-score: 5.016688359
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.557912406; Fold-change: 0.031892527; Z-score: 0.041882489
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.91042991; Fold-change: 0.271569908; Z-score: 0.441349554
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.828466593; Fold-change: 0.126679476; Z-score: 0.274391484
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.720911792; Fold-change: 0.148729278; Z-score: 0.258052146
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.71826666; Fold-change: -0.390120554; Z-score: -0.584222185
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000951603; Fold-change: -0.455737057; Z-score: -1.277452791
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.774905119; Fold-change: 0.02695654; Z-score: 0.147066342
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.824413057; Fold-change: -0.175994729; Z-score: -1.097565909
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.039449699; Fold-change: 0.229662647; Z-score: 1.022085153
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.244866308; Fold-change: -0.340282392; Z-score: -0.892013142
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.840209404; Fold-change: 0.049086065; Z-score: 0.155058884
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.053153013; Fold-change: 0.102868162; Z-score: 0.70757075
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.100418954; Fold-change: -0.110935476; Z-score: -0.438450026
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.703646027; Fold-change: 0.202937716; Z-score: 0.76819832
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.461582397; Fold-change: 0.091160335; Z-score: 0.252998742
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.065571865; Fold-change: 0.145977782; Z-score: 0.318602522
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.26E-09; Fold-change: 0.249419485; Z-score: 0.692741281
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.553996955; Fold-change: 0.007980964; Z-score: 0.036971208
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.713912694; Fold-change: 0.120163361; Z-score: 0.56986091
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.053946854; Fold-change: 0.420024772; Z-score: 0.562796453
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.203982788; Fold-change: -0.503873679; Z-score: -0.874948072
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.2506286; Fold-change: 0.367840387; Z-score: 0.449044846
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.946806394; Fold-change: -0.035244766; Z-score: -0.18776408
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.1722623; Fold-change: 0.656435263; Z-score: 0.716602191
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.644954989; Fold-change: -0.00035723; Z-score: -0.003310523
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00048093; Fold-change: -1.823976649; Z-score: -2.548186262
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.477732698; Fold-change: 0.117170494; Z-score: 0.325003761
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.871771622; Fold-change: 0.132104454; Z-score: 0.328940991
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.816944268; Fold-change: 0.053899076; Z-score: 0.057240171
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003833907; Fold-change: 0.125925641; Z-score: 0.330027199
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.048526233; Fold-change: 0.305115063; Z-score: 0.36675538
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.136168864; Fold-change: -0.017364647; Z-score: -0.0691658
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.277159737; Fold-change: -0.267311925; Z-score: -0.364145147
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.211230177; Fold-change: 0.164807705; Z-score: 0.279900836
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.189862456; Fold-change: 0.162381633; Z-score: 0.598728458
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.021828985; Fold-change: 0.765912302; Z-score: 1.273006816
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.327738923; Fold-change: 0.356591525; Z-score: 0.433945099
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.452563748; Fold-change: -0.052320075; Z-score: -0.12402255
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 8.87E-06; Fold-change: 0.524707567; Z-score: 1.099645379
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.095198147; Fold-change: -0.015302349; Z-score: -0.026251202
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 9.26E-53; Fold-change: 1.461637472; Z-score: 3.741694641
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.031058662; Fold-change: 0.494136408; Z-score: 1.170430286
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.17E-09; Fold-change: -0.551796832; Z-score: -1.648611844
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.292663171; Fold-change: 0.258100601; Z-score: 0.811071846
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.440153671; Fold-change: 0.727697228; Z-score: 0.342148303
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.443046817; Fold-change: 0.068056847; Z-score: 0.334525192
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.06504875; Fold-change: 0.035999877; Z-score: 0.105529252
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.05E-05; Fold-change: 0.720509303; Z-score: 1.753207084
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.539648936; Fold-change: 0.147491886; Z-score: 0.433684788
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.541638361; Fold-change: 0.617568846; Z-score: 1.11915277
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.750657878; Fold-change: 0.275819388; Z-score: 0.228649798
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00068898; Fold-change: 0.858938604; Z-score: 6.087782579
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.527659743; Fold-change: 0.002052332; Z-score: 0.007166908
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.09E-06; Fold-change: 0.19888128; Z-score: 0.415220198
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001054598; Fold-change: 0.505344961; Z-score: 2.192268747
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.649775574; Fold-change: -0.050978414; Z-score: -0.245310685
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.97E-08; Fold-change: 1.216598809; Z-score: 1.651103763
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 5.29E-21; Fold-change: 1.259211202; Z-score: 1.55691739
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.151962228; Fold-change: 0.367881646; Z-score: 0.619482192
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004158399; Fold-change: 0.678005781; Z-score: 1.708533032
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000272986; Fold-change: 1.257682013; Z-score: 3.046267963
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.01E-06; Fold-change: 0.18270939; Z-score: 0.267984164
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 6.82E-51; Fold-change: 1.356344561; Z-score: 1.969186959
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001634361; Fold-change: 0.819290375; Z-score: 1.14470516
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.160546618; Fold-change: 0.001725351; Z-score: 0.002588723
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.988005495; Fold-change: 0.094489617; Z-score: 0.301351963
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.062680331; Fold-change: 0.560739928; Z-score: 1.038660918
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.05167672; Fold-change: 0.277908522; Z-score: 1.677563655
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.213157145; Fold-change: -0.114754767; Z-score: -0.819882115
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.161695081; Fold-change: 0.24629572; Z-score: 0.513497335
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011867179; Fold-change: 0.123412727; Z-score: 0.551125698
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.54E-06; Fold-change: 0.395613891; Z-score: 3.066960285
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.73306694; Fold-change: -0.153425705; Z-score: -0.805183716
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001262608; Fold-change: -0.799476446; Z-score: -5.599520104
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.196856215; Fold-change: -0.207953488; Z-score: -0.618662068
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.71788624; Fold-change: -0.03099234; Z-score: -0.075342733
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.177686874; Fold-change: -0.109037134; Z-score: -0.494532874
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.438043269; Fold-change: -0.008883623; Z-score: -0.046299699
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.132233857; Fold-change: 0.164945668; Z-score: 0.532782954
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000490081; Fold-change: 1.650067056; Z-score: 3.116548109
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.121469676; Fold-change: 0.212837272; Z-score: 1.18895292
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.449294093; Fold-change: -0.014636995; Z-score: -0.063950049
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.116928939; Fold-change: 0.034282065; Z-score: 0.164466117
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.480544305; Fold-change: 0.082112989; Z-score: 0.407815199
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.058957827; Fold-change: 0.141570602; Z-score: 0.448288955
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.320643449; Fold-change: -0.036391936; Z-score: -0.115024427
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.387808682; Fold-change: -0.114767851; Z-score: -0.384694923
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.618808715; Fold-change: 0.054628779; Z-score: 0.18856395
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.67395078; Fold-change: 0.186941014; Z-score: 0.244437016
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.136803103; Fold-change: 0.623978998; Z-score: 0.840847155
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Antibody-Drug Conjugates with Pyrrole-Based KSP Inhibitors as the Payload Class. Angew Chem Int Ed Engl. 2018 Nov 12;57(46):15243-15247. doi: 10.1002/anie.201807619. Epub 2018 Oct 15.
Ref 2 Binder-wirkstoff-konjugate (adcs) und binder-prodrug-konjugate (apdcs) mit enzymatisch spaltbaren gruppen.
Ref 3 Antibody-Prodrug Conjugates with KSP Inhibitors and Legumain-Mediated Metabolite Formation. Chemistry. 2019 Jun 21;25(35):8208-8213. doi: 10.1002/chem.201900441. Epub 2019 Apr 15.
Ref 4 Antibody-drug conjugates harboring a kinesin spindle protein inhibitor with immunostimulatory properties. Oncoimmunology. 2022 Feb 9;11(1):2037216. doi: 10.1080/2162402X.2022.2037216. eCollection 2022.