Antigen ID	TAR0DBBHK
Antigen Name	Tumor necrosis factor receptor superfamily member 12A (TNFRSF12A)
Gene Name	TNFRSF12A
Gene ID	51330
Synonym	FN14; Fibroblast growth factor-inducible immediate-early response protein 14;Tweak-receptor;CD_antigen=CD266
Sequence	MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPH SDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGE GCPAVALIQ     Click to Show/Hide
Function	Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.     Click to Show/Hide
Uniprot Entry	TNR12_HUMAN
HGNC ID	HGNC:18152
KEGG ID	hsa:51330

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	TWEAKR-KSP-ADC 1.1	Pyrrole based kinesin spindle protein inhibitor	Kinesin-like protein KIF11 (KIF11)	Kinesin spindle protein inhibitor (KSPi)-ADC linker 1	[1]
ADC Info	TWEAKR-KSP-ADC 1.2	Pyrrole based kinesin spindle protein inhibitor	Kinesin-like protein KIF11 (KIF11)	Kinesin spindle protein inhibitor (KSPi)-ADC linker 2	[1]
ADC Info	TWEAKR-KSP-ADC 1.3	Pyrrole based kinesin spindle protein inhibitor	Kinesin-like protein KIF11 (KIF11)	Kinesin spindle protein inhibitor (KSPi)-ADC linker 3	[1]
ADC Info	TWEAKR-KSP-ADC 1.4	Pyrrole based kinesin spindle protein inhibitor	Kinesin-like protein KIF11 (KIF11)	Kinesin spindle protein inhibitor (KSPi)-ADC linker 4	[1]
ADC Info	TWEAKR-KSP-ADC 2.1	Pyrrole based kinesin spindle protein inhibitor	Kinesin-like protein KIF11 (KIF11)	Kinesin spindle protein inhibitor (KSPi)-ADC linker 5	[1]
ADC Info	TWEAKR-KSP-ADC 2.2	Pyrrole based kinesin spindle protein inhibitor	Kinesin-like protein KIF11 (KIF11)	Kinesin spindle protein inhibitor (KSPi)-ADC linker 6	[1]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	CN114917361A ADC-4	CN114917361A ADC-4 payload	Undisclosed	CN114917361A ADC-4 linker	[2]
ADC Info	CN114917361A ADC-5	CN114917361A ADC-5 payload	Undisclosed	CN114917361A ADC-5 linker	[2]
ADC Info	CN114917361A ADC-8	CN114917361A ADC-8 payload	Undisclosed	CN114917361A ADC-8 linker	[2]
ADC Info	CN114917361A ADC-9	CN114917361A ADC-9 payload	Undisclosed	CN114917361A ADC-9 linker	[2]
ADC Info	CN114917361A ADC-10	CN114917361A ADC-10 payload	Undisclosed	CN114917361A ADC-10 linker	[2]
ADC Info	CN114917361A ADC-12	CN114917361A ADC-12 payload	Undisclosed	CN114917361A ADC-12 linker	[2]
ADC Info	CN114917361A ADC-15	CN114917361A ADC-15 payload	Undisclosed	CN114917361A ADC-15 linker	[2]
ADC Info	CN114917361A ADC-18	CN114917361A ADC-18 payload	Undisclosed	CN114917361A ADC-18 linker	[2]
ADC Info	CN114917361A ADC-20	CN114917361A ADC-20 payload	Undisclosed	CN114917361A ADC-20 linker	[2]
ADC Info	CN114917361A ADC-23	CN114917361A ADC-23 payload	Undisclosed	CN114917361A ADC-23 linker	[2]
ADC Info	CN114917361A ADC-24	CN114917361A ADC-24 payload	Undisclosed	CN114917361A ADC-24 linker	[2]
ADC Info	CN114917361A ADC-26	CN114917361A ADC-26 payload	Undisclosed	CN114917361A ADC-26 linker	[2]
ADC Info	CN114917361A ADC-29	CN114917361A ADC-29 payload	Undisclosed	CN114917361A ADC-29 linker	[2]
ADC Info	CN114917361A ADC-32	CN114917361A ADC-32 payload	Undisclosed	CN114917361A ADC-32 linker	[2]
ADC Info	CN114917361A ADC-35	CN114917361A ADC-35 payload	Undisclosed	CN114917361A ADC-35 linker	[2]
ADC Info	CN114917361A ADC-38	CN114917361A ADC-38 payload	Undisclosed	CN114917361A ADC-38 linker	[2]
ADC Info	CN114917361A ADC-40	CN114917361A ADC-40 payload	Undisclosed	CN114917361A ADC-40 linker	[2]
ADC Info	CN114917361A ADC-43	CN114917361A ADC-43 payload	Undisclosed	CN114917361A ADC-43 linker	[2]
ADC Info	CN114917361A ADC-46	CN114917361A ADC-46 payload	Undisclosed	CN114917361A ADC-46 linker	[2]
ADC Info	CN114917361A ADC-49	CN114917361A ADC-49 payload	Undisclosed	CN114917361A ADC-49 linker	[2]
ADC Info	CN114917361A ADC-52	CN114917361A ADC-52 payload	Undisclosed	CN114917361A ADC-52 linker	[2]
ADC Info	CN114917361A ADC-53	CN114917361A ADC-53 payload	Undisclosed	CN114917361A ADC-53 linker	[2]
ADC Info	CN114917361A ADC-54	CN114917361A ADC-54 payload	Undisclosed	CN114917361A ADC-54 linker	[2]
ADC Info	CN114917361A ADC-57	CN114917361A ADC-57 payload	Undisclosed	CN114917361A ADC-57 linker	[2]
ADC Info	CN114917361A ADC-60	CN114917361A ADC-60 payload	Undisclosed	CN114917361A ADC-60 linker	[2]
ADC Info	CN114917361A ADC-63	CN114917361A ADC-63 payload	Undisclosed	CN114917361A ADC-63 linker	[2]
ADC Info	CN114917361A ADC-66	CN114917361A ADC-66 payload	Undisclosed	CN114917361A ADC-66 linker	[2]
ADC Info	CN114917361A ADC-69	CN114917361A ADC-69 payload	Undisclosed	CN114917361A ADC-69 linker	[2]
ADC Info	CN114917361A ADC-72	CN114917361A ADC-72 payload	Undisclosed	CN114917361A ADC-72 linker	[2]
ADC Info	CN114917361A ADC-75	CN114917361A ADC-75 payload	Undisclosed	CN114917361A ADC-75 linker	[2]
ADC Info	CN114917361A ADC-78	CN114917361A ADC-78 payload	Undisclosed	CN114917361A ADC-78 linker	[2]
ADC Info	CN114917361A ADC-81	CN114917361A ADC-81 payload	Undisclosed	CN114917361A ADC-81 linker	[2]
ADC Info	CN114917361A ADC-84	CN114917361A ADC-84 payload	Undisclosed	CN114917361A ADC-84 linker	[2]

ADC Info	ADC Name	Payload	Target	Linker	Ref
ADC Info	TWEAKR-KSPi-ADC2	KSP inhibitor	Kinesin-like protein KIF11 (KIF11)	Mc-peptide-based linker	[3]
ADC Info	TWEAKR-KSPi-ADC1	KSP inhibitor	Kinesin-like protein KIF11 (KIF11)	Glutaricacid-peptide-based linker	[3]
ADC Info	TWEAKR ADC 3a	Kinesin spindle protein (KSP) inhibitor 3a	Kinesin-like protein KIF11 (KIF11)	Open-chain glycine maleimide	[4]
ADC Info	TWEAKR ADC 3b	Kinesin spindle protein (KSP) inhibitor 3b	Kinesin-like protein KIF11 (KIF11)	Open-chain glycine maleimide	[4]
ADC Info	TWEAKR ADC 3c	Kinesin spindle protein (KSP) inhibitor 3c	Kinesin-like protein KIF11 (KIF11)	Open-chain glycine maleimide	[4]
ADC Info	TWEAKR ADC 3d	Kinesin spindle protein (KSP) inhibitor 3d	Kinesin-like protein KIF11 (KIF11)	Open-chain glycine maleimide	[4]
ADC Info	TWEAKR ADC 3e	Kinesin spindle protein (KSP) inhibitor 3e	Kinesin-like protein KIF11 (KIF11)	Open-chain glycine maleimide	[4]
ADC Info	TWEAKR ADC 3f	Kinesin spindle protein (KSP) inhibitor 3f	Kinesin-like protein KIF11 (KIF11)	Open-chain glycine maleimide	[4]
ADC Info	TWEAKR ADC 3g	Kinesin spindle protein (KSP) inhibitor 3g	Kinesin-like protein KIF11 (KIF11)	Open-chain glycine maleimide	[4]

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.081410407; Fold-change: 0.145971009; Z-score: 0.260586525
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Brainstem
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.519416405; Fold-change: 0.178530975; Z-score: 0.584893757
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	White matter
The Specific Disease	Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000395516; Fold-change: 1.609417932; Z-score: 1.78250366
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Brainstem
The Specific Disease	Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.163193418; Fold-change: 0.085378547; Z-score: 0.303460785
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Nervous
The Specific Disease	Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.05E-43; Fold-change: 0.579606752; Z-score: 1.180543433
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.25E-10; Fold-change: 0.32975321; Z-score: 1.51517166
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Whole blood
The Specific Disease	Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.022879508; Fold-change: 0.146612451; Z-score: 0.686314935
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.03769113; Fold-change: -0.185605395; Z-score: -0.478464848
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.326785775; Fold-change: 0.01380786; Z-score: 0.049703479
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Tonsil
The Specific Disease	Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.212802423; Fold-change: -0.184324576; Z-score: -1.366995136
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric
The Specific Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.154759377; Fold-change: 1.290440513; Z-score: 1.433455055
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.00145845; Fold-change: 0.993056779; Z-score: 1.26579444
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon
The Specific Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.81E-44; Fold-change: 0.953641013; Z-score: 1.569285554
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.53E-43; Fold-change: 0.977859301; Z-score: 1.909040164
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pancreas
The Specific Disease	Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001118367; Fold-change: 0.704041773; Z-score: 1.057020726
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002966519; Fold-change: 0.418013961; Z-score: 0.522688753
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003863603; Fold-change: 0.269799763; Z-score: 0.456665489
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.051663956; Fold-change: -0.1041222; Z-score: -0.162887107
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.842396999; Fold-change: -0.127449168; Z-score: -0.162628439
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.01E-06; Fold-change: 0.348748787; Z-score: 0.489831317
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.168340431; Fold-change: 0.222256243; Z-score: 0.260056981
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.588370766; Fold-change: 0.658229679; Z-score: 0.434742146
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 2.53E-12; Fold-change: 0.384573226; Z-score: 0.488945575
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.081445318; Fold-change: 0.187859029; Z-score: 0.472695452
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Breast
The Specific Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.70E-33; Fold-change: 0.975705924; Z-score: 1.15598958
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.05E-05; Fold-change: 0.481169288; Z-score: 0.60779673
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Ovarian
The Specific Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004264962; Fold-change: 1.274145734; Z-score: 1.402481601
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.478552693; Fold-change: 0.366357211; Z-score: 0.215243761
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Cervical
The Specific Disease	Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.008215515; Fold-change: 0.511530402; Z-score: 0.849373524
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000172508; Fold-change: 0.553565663; Z-score: 0.522458683
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.002504759; Fold-change: -1.75442709; Z-score: -3.038402327
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Prostate
The Specific Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.056962017; Fold-change: -0.592313343; Z-score: -0.492950396
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 9.80E-16; Fold-change: 1.423727265; Z-score: 8.111978853
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Uvea
The Specific Disease	Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.741824456; Fold-change: 0.264128132; Z-score: 0.47175174
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Thyroid
The Specific Disease	Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.21E-41; Fold-change: 2.267443697; Z-score: 2.489504051
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.52E-15; Fold-change: 2.820592423; Z-score: 2.432161283
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adrenal cortex
The Specific Disease	Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.001023646; Fold-change: 0.168319894; Z-score: 0.427106602
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Head and neck
The Specific Disease	Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.12E-58; Fold-change: 1.562134119; Z-score: 5.016688359
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pituitary
The Specific Disease	Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.557912406; Fold-change: 0.031892527; Z-score: 0.041882489
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Pituitary
The Specific Disease	Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.91042991; Fold-change: 0.271569908; Z-score: 0.441349554
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.828466593; Fold-change: 0.126679476; Z-score: 0.274391484
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.720911792; Fold-change: 0.148729278; Z-score: 0.258052146
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral monocyte
The Specific Disease	Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.71826666; Fold-change: -0.390120554; Z-score: -0.584222185
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000951603; Fold-change: -0.455737057; Z-score: -1.277452791
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Superior temporal cortex
The Specific Disease	Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.774905119; Fold-change: 0.02695654; Z-score: 0.147066342
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Spinal cord
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.824413057; Fold-change: -0.175994729; Z-score: -1.097565909
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue
The Studied Tissue	Plasmacytoid dendritic cells
The Specific Disease	Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.039449699; Fold-change: 0.229662647; Z-score: 1.022085153
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peritumoral cortex
The Specific Disease	Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section	p-value: 0.244866308; Fold-change: -0.340282392; Z-score: -0.892013142
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of the other disease section

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.840209404; Fold-change: 0.049086065; Z-score: 0.155058884
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.053153013; Fold-change: 0.102868162; Z-score: 0.70757075
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	White matter
The Specific Disease	HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.100418954; Fold-change: -0.110935476; Z-score: -0.438450026
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.703646027; Fold-change: 0.202937716; Z-score: 0.76819832
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.461582397; Fold-change: 0.091160335; Z-score: 0.252998742
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.065571865; Fold-change: 0.145977782; Z-score: 0.318602522
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.26E-09; Fold-change: 0.249419485; Z-score: 0.692741281
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.553996955; Fold-change: 0.007980964; Z-score: 0.036971208
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.713912694; Fold-change: 0.120163361; Z-score: 0.56986091
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.053946854; Fold-change: 0.420024772; Z-score: 0.562796453
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.203982788; Fold-change: -0.503873679; Z-score: -0.874948072
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Calcified aortic valve
The Specific Disease	Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.2506286; Fold-change: 0.367840387; Z-score: 0.449044846
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.946806394; Fold-change: -0.035244766; Z-score: -0.18776408
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Intracranial artery
The Specific Disease	Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.1722623; Fold-change: 0.656435263; Z-score: 0.716602191
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.644954989; Fold-change: -0.00035723; Z-score: -0.003310523
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Hyperplastic tonsil
The Specific Disease	Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00048093; Fold-change: -1.823976649; Z-score: -2.548186262
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.477732698; Fold-change: 0.117170494; Z-score: 0.325003761
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Sinus mucosa
The Specific Disease	Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.871771622; Fold-change: 0.132104454; Z-score: 0.328940991
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.816944268; Fold-change: 0.053899076; Z-score: 0.057240171
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Small airway epithelium
The Specific Disease	Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.003833907; Fold-change: 0.125925641; Z-score: 0.330027199
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal and bronchial airway
The Specific Disease	Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.048526233; Fold-change: 0.305115063; Z-score: 0.36675538
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Nasal Epithelium
The Specific Disease	Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.136168864; Fold-change: -0.017364647; Z-score: -0.0691658
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Lung
The Specific Disease	Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.277159737; Fold-change: -0.267311925; Z-score: -0.364145147
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Gingival
The Specific Disease	Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.211230177; Fold-change: 0.164807705; Z-score: 0.279900836
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Gastric antrum
The Specific Disease	Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.189862456; Fold-change: 0.162381633; Z-score: 0.598728458
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.021828985; Fold-change: 0.765912302; Z-score: 1.273006816
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Colon mucosal
The Specific Disease	Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.327738923; Fold-change: 0.356591525; Z-score: 0.433945099
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.452563748; Fold-change: -0.052320075; Z-score: -0.12402255
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.87E-06; Fold-change: 0.524707567; Z-score: 1.099645379
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.095198147; Fold-change: -0.015302349; Z-score: -0.026251202
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 9.26E-53; Fold-change: 1.461637472; Z-score: 3.741694641
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.031058662; Fold-change: 0.494136408; Z-score: 1.170430286
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin from scalp
The Specific Disease	Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.17E-09; Fold-change: -0.551796832; Z-score: -1.648611844
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.292663171; Fold-change: 0.258100601; Z-score: 0.811071846
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.440153671; Fold-change: 0.727697228; Z-score: 0.342148303
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.443046817; Fold-change: 0.068056847; Z-score: 0.334525192
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.06504875; Fold-change: 0.035999877; Z-score: 0.105529252
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Synovial
The Specific Disease	Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 6.05E-05; Fold-change: 0.720509303; Z-score: 1.753207084
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Pheripheral blood
The Specific Disease	Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.539648936; Fold-change: 0.147491886; Z-score: 0.433684788
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.541638361; Fold-change: 0.617568846; Z-score: 1.11915277
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Endometrium
The Specific Disease	Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.750657878; Fold-change: 0.275819388; Z-score: 0.228649798
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bladder
The Specific Disease	Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.00068898; Fold-change: 0.858938604; Z-score: 6.087782579
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Myometrium
The Specific Disease	Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.527659743; Fold-change: 0.002052332; Z-score: 0.007166908
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.09E-06; Fold-change: 0.19888128; Z-score: 0.415220198
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001054598; Fold-change: 0.505344961; Z-score: 2.192268747
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Peripheral blood
The Specific Disease	Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.649775574; Fold-change: -0.050978414; Z-score: -0.245310685
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Oral
The Specific Disease	Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.97E-08; Fold-change: 1.216598809; Z-score: 1.651103763
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.29E-21; Fold-change: 1.259211202; Z-score: 1.55691739
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Esophagus
The Specific Disease	Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.151962228; Fold-change: 0.367881646; Z-score: 0.619482192
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Rectal colon
The Specific Disease	Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.004158399; Fold-change: 0.678005781; Z-score: 1.708533032
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.000272986; Fold-change: 1.257682013; Z-score: 3.046267963
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 3.01E-06; Fold-change: 0.18270939; Z-score: 0.267984164
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 6.82E-51; Fold-change: 1.356344561; Z-score: 1.969186959
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Kidney
The Specific Disease	Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.001634361; Fold-change: 0.819290375; Z-score: 1.14470516
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.160546618; Fold-change: 0.001725351; Z-score: 0.002588723
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Urothelium
The Specific Disease	Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.988005495; Fold-change: 0.094489617; Z-score: 0.301351963
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Adipose
The Specific Disease	Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.062680331; Fold-change: 0.560739928; Z-score: 1.038660918
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Perituberal
The Specific Disease	Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.05167672; Fold-change: 0.277908522; Z-score: 1.677563655
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Bone marrow
The Specific Disease	Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.213157145; Fold-change: -0.114754767; Z-score: -0.819882115
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.161695081; Fold-change: 0.24629572; Z-score: 0.513497335
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.011867179; Fold-change: 0.123412727; Z-score: 0.551125698
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 5.54E-06; Fold-change: 0.395613891; Z-score: 3.066960285
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Salivary gland
The Specific Disease	Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.73306694; Fold-change: -0.153425705; Z-score: -0.805183716
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 0.001262608; Fold-change: -0.799476446; Z-score: -5.599520104
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the normal section of the tissue adjacent to the disease section Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Peripheral blood
The Specific Disease	Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.196856215; Fold-change: -0.207953488; Z-score: -0.618662068
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.71788624; Fold-change: -0.03099234; Z-score: -0.075342733
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Liver
The Specific Disease	Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.177686874; Fold-change: -0.109037134; Z-score: -0.494532874
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Vastus lateralis muscle
The Specific Disease	Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.438043269; Fold-change: -0.008883623; Z-score: -0.046299699
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Subcutaneous Adipose
The Specific Disease	Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.132233857; Fold-change: 0.164945668; Z-score: 0.532782954
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Biceps muscle
The Specific Disease	Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.000490081; Fold-change: 1.650067056; Z-score: 3.116548109
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.121469676; Fold-change: 0.212837272; Z-score: 1.18895292
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.449294093; Fold-change: -0.014636995; Z-score: -0.063950049
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.116928939; Fold-change: 0.034282065; Z-score: 0.164466117
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Substantia nigra
The Specific Disease	Parkinson disease
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.480544305; Fold-change: 0.082112989; Z-score: 0.407815199
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Entorhinal cortex
The Specific Disease	Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.058957827; Fold-change: 0.141570602; Z-score: 0.448288955
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Whole blood
The Specific Disease	Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.320643449; Fold-change: -0.036391936; Z-score: -0.115024427
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Skin
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.387808682; Fold-change: -0.114767851; Z-score: -0.384694923
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual
The Studied Tissue	Cervical spinal cord
The Specific Disease	Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.618808715; Fold-change: 0.054628779; Z-score: 0.18856395
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.67395078; Fold-change: 0.186941014; Z-score: 0.244437016
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Differential expression pattern of antigen in diseases
The Studied Tissue	Muscle
The Specific Disease	Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 0.136803103; Fold-change: 0.623978998; Z-score: 0.840847155
Disease-specific Antigen Abundances		Click to View the Clearer Original Diagram
Download Antigen expression data of patients in the disease section of the tissue Download Antigen expression data in the tissue of healthy individual

Ref 1	Antibody-Drug Conjugates with Pyrrole-Based KSP Inhibitors as the Payload Class. Angew Chem Int Ed Engl. 2018 Nov 12;57(46):15243-15247. doi: 10.1002/anie.201807619. Epub 2018 Oct 15.
Ref 2	Binder-wirkstoff-konjugate (adcs) und binder-prodrug-konjugate (apdcs) mit enzymatisch spaltbaren gruppen.
Ref 3	Antibody-drug conjugates harboring a kinesin spindle protein inhibitor with immunostimulatory properties. Oncoimmunology. 2022 Feb 9;11(1):2037216. doi: 10.1080/2162402X.2022.2037216. eCollection 2022.
Ref 4	Antibody-Prodrug Conjugates with KSP Inhibitors and Legumain-Mediated Metabolite Formation. Chemistry. 2019 Jun 21;25(35):8208-8213. doi: 10.1002/chem.201900441. Epub 2019 Apr 15.