Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0YOMUU |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | plozalizumab |
|||||
| Antigen Name | CCR2 |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
EVQLVESGGGLVKPGGSLRLSCAASGFTFSAYAMNWVRQAPGKGLEWVGRIRTKNNNYAT
YYADSVKDRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTTFYGNGVWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELAGAPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DVVMTQSPLSLPVTLGQPASISCKSSQSLLDSDGKTFLNWFQQRPGQSPRRLIYLVSKLD
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFPYTFGQGTRLEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Plozalizumab plevistinag [Phase 1/2 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligible participants (ECOG 0-1) have advanced solid tumors (e.g., NSCLC, pancreatic adenocarcinoma, RCC) refractory to prior therapies, with specific requirements per cohort (e.g., 2L NSCLC: anti-PD- (L)1 progression; 3L RCC: prior VEGFR TKI + immunotherapy). Key exclusions: cardiac/pulmonary dysfunction (NYHA III-IV, pneumonitis), uncontrolled hepatitis, recent immunosuppressants/radiotherapy, or hypersensitivity to study drugs. Lab thresholds include ANC ≥1000/uL, creatinine clearance ≥30 mL/min, and LVEF >50%. HCC requires Child-Pugh ≤7.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05070247 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
An Open-label, Dose Escalation and Expansion, Phase 1/2 Study to Evaluate the Safety, Tolerability, Pharmacokinetics, Pharmacodynamics, and Preliminary Antitumor Activity of TAK-500, a Novel Stimulator of Interferon Genes Agonist, as a Single Agent and in Combination With Pembrolizumab in Adult Patients With Select Locally Advanced or Metastatic Solid Tumors
Click to Show/Hide
|
||||
| Primary Endpoint |
The study evaluates safety endpoints including Grade ≥3 TEAEs, SAEs, DLTs (Cycle 1, per NCI CTCAE v5.0), and treatment modifications/discontinuations over ~50 months. Efficacy in dose expansion focuses on ORR (confirmed PR/CR per RECIST 1.1), DCR (CR+PR+SD >6 weeks), DOR, TTR, PFS, and OS, with RECIST-defined tumor assessments.
|
||||
| Other Endpoint |
Pharmacokinetics of TAK-500 (single/multi-dose) include Cmax, Tmax, AUCt, AUCinf, t1/2, CL, and Vss, measured during Cycles 1-4. Biomarkers assess intratumoral immune cell changes (IHC/ISH) and ADA immunogenicity. Tumor response metrics (ORR/DCR/DOR/TTR in escalation/expansion) follow RECIST 1.1, while survival endpoints (PFS/OS) track progression/death over ~50 months.
Click to Show/Hide
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT04879849 | Clinical Status | Phase 1 | ||
| Clinical Description |
An open-label, phase 1, dose-escalation study to evaluate the safety and preliminary antitumor activity of TAK-676 with pembrolizumab following radiation therapy in the treatment of non-small-cell lung cancer, triple-negative breast cancer, or squamous-cell carcinoma of the head and neck that has progressed on checkpoint inhibitors.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT04420884 | Clinical Status | Phase 1 | ||
| Clinical Description |
An open-label, dose escalation, phase 1 study to evaluate the safety, tolerability, pharmacokinetics, and pharmacodynamics of TAK-676 as a single agent and in combination with pembrolizumab in adult patients with advanced or metastatic solid tumors.
|
||||
References
