Antigen Information
General Information of This Antigen
| Antigen ID | TAR0QMHZX |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | C-C chemokine receptor type 2 (CCR2) |
|||||
| Gene Name | CCR2 |
|||||
| Gene ID | ||||||
| Synonym | CMKBR2; Monocyte chemoattractant protein 1 receptor;CD_antigen=CD192 |
|||||
| Sequence |
MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGN
MLVVLILINCKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLY HIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTK CQKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRCRNEKKRHR AVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCI NPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSI GRAPEASLQDKEGA Click to Show/Hide
|
|||||
| Family | G-protein coupled receptor 1 family |
|||||
| Function |
Key functional receptor for CCL2 but can also bind CCL7 and CCL12. Its binding with CCL2 on monocytes and macrophages mediates chemotaxis and migration induction through the activation of the PI3K cascade, the small G protein Rac and lamellipodium protrusion (Probable). Also acts as a receptor for the beta-defensin DEFB106A/DEFB106B. Regulates the expression of T-cell inflammatory cytokines and T-cell differentiation, promoting the differentiation of T-cells into T-helper 17 cells (Th17) during inflammation. Facilitates the export of mature thymocytes by enhancing directional movement of thymocytes to sphingosine-1-phosphate stimulation and up-regulation of S1P1R expression; signals through the JAK-STAT pathway to regulate FOXO1 activity leading to an increased expression of S1P1R. Plays an important role in mediating peripheral nerve injury-induced neuropathic pain. Increases NMDA-mediated synaptic transmission in both dopamine D1 and D2 receptor-containing neurons, which may be caused by MAPK/ERK-dependent phosphorylation of GRIN2B/NMDAR2B. Mediates the recruitment of macrophages and monocytes to the injury site following brain injury.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
hIgG4
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
CN116916962A-ADC-B1 |
Compound I-5c |
Undisclosed |
Mc-Val-Ala-PABC |
[1] | |
CN116916962A-ADC-B2 |
Compound No.14 |
Undisclosed |
Mc-Val-Ala-PABC |
[1] | |
CN116916962A-ADC-B3 |
Compound I-5c |
Undisclosed |
Mc-Val-Ala-PABC |
[1] | |
CN116916962A-ADC-B4 |
Compound No.14 |
Undisclosed |
CN116916962A-C-22-linker |
[1] | |
CN116916962A-ADC-B5 |
Compound No.14 |
Undisclosed |
Mc-Val-Ala-PABC |
[1] | |
CN116916962A-ADC-B6 |
Compound I-5c |
Undisclosed |
CN116916962A-C-5-linker |
[1] | |
CN116916962A-ADC-B7 |
Compound I-5c |
Undisclosed |
Mc-Val-Ala-PABC |
[1] | |
CN116916962A-ADC-B8 |
Compound I-5c |
Undisclosed |
CN116916962A-C-10-linker |
[1] | |
CN116916962A-ADC-B9 |
Compound I-5c |
Undisclosed |
CN116916962A-C-15-linker |
[1] | |
CN116916962A-ADC-B10 |
Compound I-5c |
Undisclosed |
CN116916962A-C-15-linker |
[1] | |
CN116916962A-ADC-B11 |
Compound I-5c |
Undisclosed |
CN116916962A-C-13-linker |
[1] | |
CN116916962A-ADC-B12 |
Compound I-5c |
Undisclosed |
CN116916962A-C-9-linker |
[1] | |
CN116916962A-ADC-B13 |
Compound I-5c |
Undisclosed |
CN116916962A-C-8-linker |
[1] |
MC-21
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
CN116916962A-ADC-B21 |
Compound No.14 |
Undisclosed |
CN116916962A-C-38-linker |
[1] |
Plozalizumab
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Plozalizumab plevistinag |
Dazostinag (TAK-676) |
Stimulator of interferon genes protein (STING1) |
Maleimido-caproyl-PEG8-Val-Ala-PABC |
