General Information of This Antibody (ID: ANTI0XTMGG)
Antibody Name
A humanized anti-FLT3 IgG1κ mAb
Antigen Name
Flt3
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVRPGGSLRLSCAASGFTFSGYSINWVRQAPGKGLEWVSSISSSSNYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGFIAGTTFDAFDIWGQGTMVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Varible Domain
EVQLVESGGGLVRPGGSLRLSCAASGFTFSGYSINWVRQAPGKGLEWVSSISSSSNYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGFIAGTTFDAFDIWGQGTMVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL
LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE
QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS
RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNGFPYTFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS
RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNGFPYTFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AGS62P1 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Partial Response (PR)
19%
Patients Enrolled
Eligible subjects have relapsed/refractory AML (≤3 prior lines), ECOG ≤2, adequate organ function, and contraception compliance. Exclusions include APL, neuropathy ≥G2, active infections, GVHD on steroids >10mg/day, significant cardiac/ocular conditions, or drug component hypersensitivity.
Administration Dosage
The study was designed to evaluate 3 different dosing schedules of ASP1235 administered as 30-minute IV infusions. In dosing schedule A, patients received 1 dose of ASP1235 administered once every 3 weeks (Q3W) of a 21-day cycle. In dosing schedule B, patients would have received 1 dose of ASP1235 every other week of a 28-day cycle. No patients were treated on schedule B. In dosing schedule C, patients were to receive 1 fractionated dose weekly for the first 3 weeks of a 28-day cycle. A fractionated dose was the selected schedule A dose divided into 3 weekly doses in schedule C. Dose escalation in dosing schedule A was initially performed using an accelerated titration design with 1 patient per dose cohort until a grade ≥ 2 adverse event (AE) occurred (Supplemental Fig. S1). There were 6 dose cohorts in the schedule A Q3W dosing schedule (cohort 1, 0.8 mg/kg; cohort 2, 1.6 mg/kg; cohort 3, 3.2 mg/kg; cohort 4, 4.8 mg/kg; cohort 5, 6.0 mg/kg; cohort 6, 7.5 mg/kg). Two additional cohorts were added based on specific circumstances: cohort -1 (de-escalation cohort if the starting dose from cohort 1 was not tolerated) and cohort 6b (an additional cohort was evaluated to assess the 7.5-mg/kg dose level with the implementation of the protocol-required prophylactic eye regimen). The initial dose in dosing schedule B or C would be calculated based on the pharmacokinetic and safety data in dosing schedule A. After completion of Q3W dosing in schedule A, the data review team recommended once-weekly dosing (dosing schedule C) which followed a 3 + 3 design; the starting dose was 7.5 mg/kg split (fractionated) into 3 doses of 2.5 mg/kg per week for the first 3 weeks of a 4-week cycle.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT02864290  Clinical Status PHASE1
Clinical Description
A Phase 1 Study Evaluating Safety, Tolerability, and Pharmacokinetics of Escalating Doses of ASP1235 (AGS62P1) Given as Monotherapy in Subjects With Acute Myeloid Leukemia (AML)
Primary Endpoint
The study evaluates adverse events (AEs) using NCI CTCAE v4.03 over 30 months, focusing on incidence and severity.
Other Endpoint
Key outcomes include ADA formation against AGS62P and ASP1235, with multiple response and pharmacokinetic measures over 30-46 months, covering CR, CRc, MLFS, Cmax, Tmax, AUC, t1/2, CL, and Vss across dose escalation and expansion phases.
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Complete response (CR)
7%
Patients Enrolled
Eligible subjects have relapsed/refractory AML (≤3 prior lines), ECOG ≤2, adequate organ function, and contraception compliance. Exclusions include APL, neuropathy ≥G2, active infections, GVHD on steroids >10mg/day, significant cardiac/ocular conditions, or drug component hypersensitivity.
Administration Dosage
The study was designed to evaluate 3 different dosing schedules of ASP1235 administered as 30-minute IV infusions. In dosing schedule A, patients received 1 dose of ASP1235 administered once every 3 weeks (Q3W) of a 21-day cycle. In dosing schedule B, patients would have received 1 dose of ASP1235 every other week of a 28-day cycle. No patients were treated on schedule B. In dosing schedule C, patients were to receive 1 fractionated dose weekly for the first 3 weeks of a 28-day cycle. A fractionated dose was the selected schedule A dose divided into 3 weekly doses in schedule C. Dose escalation in dosing schedule A was initially performed using an accelerated titration design with 1 patient per dose cohort until a grade ≥ 2 adverse event (AE) occurred (Supplemental Fig. S1). There were 6 dose cohorts in the schedule A Q3W dosing schedule (cohort 1, 0.8 mg/kg; cohort 2, 1.6 mg/kg; cohort 3, 3.2 mg/kg; cohort 4, 4.8 mg/kg; cohort 5, 6.0 mg/kg; cohort 6, 7.5 mg/kg). Two additional cohorts were added based on specific circumstances: cohort -1 (de-escalation cohort if the starting dose from cohort 1 was not tolerated) and cohort 6b (an additional cohort was evaluated to assess the 7.5-mg/kg dose level with the implementation of the protocol-required prophylactic eye regimen). The initial dose in dosing schedule B or C would be calculated based on the pharmacokinetic and safety data in dosing schedule A. After completion of Q3W dosing in schedule A, the data review team recommended once-weekly dosing (dosing schedule C) which followed a 3 + 3 design; the starting dose was 7.5 mg/kg split (fractionated) into 3 doses of 2.5 mg/kg per week for the first 3 weeks of a 4-week cycle.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT02864290  Clinical Status PHASE1
Clinical Description
A Phase 1 Study Evaluating Safety, Tolerability, and Pharmacokinetics of Escalating Doses of ASP1235 (AGS62P1) Given as Monotherapy in Subjects With Acute Myeloid Leukemia (AML)
Primary Endpoint
The study evaluates adverse events (AEs) using NCI CTCAE v4.03 over 30 months, focusing on incidence and severity.
Other Endpoint
Key outcomes include ADA formation against AGS62P and ASP1235, with multiple response and pharmacokinetic measures over 30-46 months, covering CR, CRc, MLFS, Cmax, Tmax, AUC, t1/2, CL, and Vss across dose escalation and expansion phases.
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
27%
Positive FLT3 Expression (FLT3+++/++)
Method Description
The in vivo antitumor activity of ASP1235 was evaluated in a FLT3 positive THP-1 xenograft model. THP-1 cells were subcutaneously inoculated in the right frank of mice at 5 x106 cells/head. The vehicle of each drug is shown as follows: ASP1235 (20 mM Histidine/L-Histidine-HCl, 5.5% trehalose dihydrate, 0.01% Polysorbate 20, pH6.0), venetoclax (60% phosal 50PG, 30% PEG400, 10% ethanol), azacitidine (PBS). ASP1235 was intravenously administrated to each mouse once per week. One day before ASP1235 treatment, each mouse received intraperitoneal injection of 20 mg/kg of nonspecific human IgG1 antibody. Venetoclax was orally administered daily at 100 mg/kg. Azacitidine was intravenously injected at 3 mg/kg for five consecutive days in the first week of treatment.

   Click to Show/Hide
In Vivo Model FLT3-expressing THP-1 xenograft model
In Vitro Model Childhood acute monocytic leukemia THP-1 cells CVCL_0006
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
35.10%
Positive FLT3 Expression (FLT3+++/++)
Method Description
The in vivo antitumor activity of ASP1235 was evaluated in a FLT3 positive THP-1 xenograft model. THP-1 cells were subcutaneously inoculated in the right frank of mice at 5 x106 cells/head. The vehicle of each drug is shown as follows: ASP1235 (20 mM Histidine/L-Histidine-HCl, 5.5% trehalose dihydrate, 0.01% Polysorbate 20, pH6.0), venetoclax (60% phosal 50PG, 30% PEG400, 10% ethanol), azacitidine (PBS). ASP1235 was intravenously administrated to each mouse once per week. One day before ASP1235 treatment, each mouse received intraperitoneal injection of 20 mg/kg of nonspecific human IgG1 antibody. Venetoclax was orally administered daily at 100 mg/kg. Azacitidine was intravenously injected at 3 mg/kg for five consecutive days in the first week of treatment.

   Click to Show/Hide
In Vivo Model FLT3-expressing THP-1 xenograft model
In Vitro Model Childhood acute monocytic leukemia THP-1 cells CVCL_0006
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
38%
Positive FLT3 Expression (FLT3+++/++)
Method Description
The in vivo antitumor activity of ASP1235 was evaluated in a FLT3 positive THP-1 xenograft model. THP-1 cells were subcutaneously inoculated in the right frank of mice at 5 x106 cells/head. The vehicle of each drug is shown as follows: ASP1235 (20 mM Histidine/L-Histidine-HCl, 5.5% trehalose dihydrate, 0.01% Polysorbate 20, pH6.0), venetoclax (60% phosal 50PG, 30% PEG400, 10% ethanol), azacitidine (PBS). ASP1235 was intravenously administrated to each mouse once per week. One day before ASP1235 treatment, each mouse received intraperitoneal injection of 20 mg/kg of nonspecific human IgG1 antibody. Venetoclax was orally administered daily at 100 mg/kg. Azacitidine was intravenously injected at 3 mg/kg for five consecutive days in the first week of treatment.

   Click to Show/Hide
In Vivo Model FLT3-expressing THP-1 xenograft model
In Vitro Model Childhood acute monocytic leukemia THP-1 cells CVCL_0006
Experiment 4 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI)
84%
Positive FLT3 Expression (FLT3+++/++)
Method Description
The in vivo antitumor activity of ASP1235 was evaluated in a FLT3 positive THP-1 xenograft model. THP-1 cells were subcutaneously inoculated in the right frank of mice at 5 x106 cells/head. The vehicle of each drug is shown as follows: ASP1235 (20 mM Histidine/L-Histidine-HCl, 5.5% trehalose dihydrate, 0.01% Polysorbate 20, pH6.0), venetoclax (60% phosal 50PG, 30% PEG400, 10% ethanol), azacitidine (PBS). ASP1235 was intravenously administrated to each mouse once per week. One day before ASP1235 treatment, each mouse received intraperitoneal injection of 20 mg/kg of nonspecific human IgG1 antibody. Venetoclax was orally administered daily at 100 mg/kg. Azacitidine was intravenously injected at 3 mg/kg for five consecutive days in the first week of treatment.

   Click to Show/Hide
In Vivo Model FLT3-expressing THP-1 xenograft model
In Vitro Model Childhood acute monocytic leukemia THP-1 cells CVCL_0006
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.20-12.00 nM
Positive FLT3 Expression (FLT3+++/++)
Method Description
The cytotoxic activity of AGS-62P1 was evaluated against a panel of AmL cell lines in vitro.
In Vitro Model Acute myeloid leukemia Acute myeloid leukemia cells Homo sapiens
References
Ref 1 A Study to Evaluate Escalating Doses of ASP1235 (AGS62P1) Given as Monotherapy in Subjects With Acute Myeloid Leukemia (AML)
Ref 2 Anti-tumor effect of antibody drug conjugate ASP1235 targeting Fms-like tyrosine kinase 3 with venetoclax plus azacitidine in an acute myeloid leukemia xenograft mouse model. Oncotarget. 2022 Dec 20;13:1359-1368.
Ref 3 AGS62P1, a novel site-specific antibody drug conjugate targeting FLT3 exhibits potent anti-tumor activity regardless of FLT3 kinase activation status.