Antibody Information
General Information of This Antibody (ID: ANTI0XTMGG)
| Antibody Name | A humanized anti-FLT3 IgG1κ mAb |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Flt3 |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVRPGGSLRLSCAASGFTFSGYSINWVRQAPGKGLEWVSSISSSSNYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGFIAGTTFDAFDIWGQGTMVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
EVQLVESGGGLVRPGGSLRLSCAASGFTFSGYSINWVRQAPGKGLEWVSSISSSSNYIYY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGFIAGTTFDAFDIWGQGTMVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS
RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNGFPYTFGQGTKLEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS
RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNGFPYTFGQGTKLEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AGS62P1 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Partial Response (PR) |
19%
|
|||
| Patients Enrolled |
Eligible subjects have relapsed/refractory AML (≤3 prior lines), ECOG ≤2, adequate organ function, and contraception compliance. Exclusions include APL, neuropathy ≥G2, active infections, GVHD on steroids >10mg/day, significant cardiac/ocular conditions, or drug component hypersensitivity.
|
||||
| Administration Dosage |
The study was designed to evaluate 3 different dosing schedules of ASP1235 administered as 30-minute IV infusions. In dosing schedule A, patients received 1 dose of ASP1235 administered once every 3 weeks (Q3W) of a 21-day cycle. In dosing schedule B, patients would have received 1 dose of ASP1235 every other week of a 28-day cycle. No patients were treated on schedule B. In dosing schedule C, patients were to receive 1 fractionated dose weekly for the first 3 weeks of a 28-day cycle. A fractionated dose was the selected schedule A dose divided into 3 weekly doses in schedule C. Dose escalation in dosing schedule A was initially performed using an accelerated titration design with 1 patient per dose cohort until a grade ≥ 2 adverse event (AE) occurred (Supplemental Fig. S1). There were 6 dose cohorts in the schedule A Q3W dosing schedule (cohort 1, 0.8 mg/kg; cohort 2, 1.6 mg/kg; cohort 3, 3.2 mg/kg; cohort 4, 4.8 mg/kg; cohort 5, 6.0 mg/kg; cohort 6, 7.5 mg/kg). Two additional cohorts were added based on specific circumstances: cohort -1 (de-escalation cohort if the starting dose from cohort 1 was not tolerated) and cohort 6b (an additional cohort was evaluated to assess the 7.5-mg/kg dose level with the implementation of the protocol-required prophylactic eye regimen). The initial dose in dosing schedule B or C would be calculated based on the pharmacokinetic and safety data in dosing schedule A. After completion of Q3W dosing in schedule A, the data review team recommended once-weekly dosing (dosing schedule C) which followed a 3 + 3 design; the starting dose was 7.5 mg/kg split (fractionated) into 3 doses of 2.5 mg/kg per week for the first 3 weeks of a 4-week cycle.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02864290 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1 Study Evaluating Safety, Tolerability, and Pharmacokinetics of Escalating Doses of ASP1235 (AGS62P1) Given as Monotherapy in Subjects With Acute Myeloid Leukemia (AML)
|
||||
| Primary Endpoint |
The study evaluates adverse events (AEs) using NCI CTCAE v4.03 over 30 months, focusing on incidence and severity.
|
||||
| Other Endpoint |
Key outcomes include ADA formation against AGS62P and ASP1235, with multiple response and pharmacokinetic measures over 30-46 months, covering CR, CRc, MLFS, Cmax, Tmax, AUC, t1/2, CL, and Vss across dose escalation and expansion phases.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Complete response (CR) |
7%
|
|||
| Patients Enrolled |
Eligible subjects have relapsed/refractory AML (≤3 prior lines), ECOG ≤2, adequate organ function, and contraception compliance. Exclusions include APL, neuropathy ≥G2, active infections, GVHD on steroids >10mg/day, significant cardiac/ocular conditions, or drug component hypersensitivity.
|
||||
| Administration Dosage |
The study was designed to evaluate 3 different dosing schedules of ASP1235 administered as 30-minute IV infusions. In dosing schedule A, patients received 1 dose of ASP1235 administered once every 3 weeks (Q3W) of a 21-day cycle. In dosing schedule B, patients would have received 1 dose of ASP1235 every other week of a 28-day cycle. No patients were treated on schedule B. In dosing schedule C, patients were to receive 1 fractionated dose weekly for the first 3 weeks of a 28-day cycle. A fractionated dose was the selected schedule A dose divided into 3 weekly doses in schedule C. Dose escalation in dosing schedule A was initially performed using an accelerated titration design with 1 patient per dose cohort until a grade ≥ 2 adverse event (AE) occurred (Supplemental Fig. S1). There were 6 dose cohorts in the schedule A Q3W dosing schedule (cohort 1, 0.8 mg/kg; cohort 2, 1.6 mg/kg; cohort 3, 3.2 mg/kg; cohort 4, 4.8 mg/kg; cohort 5, 6.0 mg/kg; cohort 6, 7.5 mg/kg). Two additional cohorts were added based on specific circumstances: cohort -1 (de-escalation cohort if the starting dose from cohort 1 was not tolerated) and cohort 6b (an additional cohort was evaluated to assess the 7.5-mg/kg dose level with the implementation of the protocol-required prophylactic eye regimen). The initial dose in dosing schedule B or C would be calculated based on the pharmacokinetic and safety data in dosing schedule A. After completion of Q3W dosing in schedule A, the data review team recommended once-weekly dosing (dosing schedule C) which followed a 3 + 3 design; the starting dose was 7.5 mg/kg split (fractionated) into 3 doses of 2.5 mg/kg per week for the first 3 weeks of a 4-week cycle.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02864290 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1 Study Evaluating Safety, Tolerability, and Pharmacokinetics of Escalating Doses of ASP1235 (AGS62P1) Given as Monotherapy in Subjects With Acute Myeloid Leukemia (AML)
|
||||
| Primary Endpoint |
The study evaluates adverse events (AEs) using NCI CTCAE v4.03 over 30 months, focusing on incidence and severity.
|
||||
| Other Endpoint |
Key outcomes include ADA formation against AGS62P and ASP1235, with multiple response and pharmacokinetic measures over 30-46 months, covering CR, CRc, MLFS, Cmax, Tmax, AUC, t1/2, CL, and Vss across dose escalation and expansion phases.
|
||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
27%
|
Positive FLT3 Expression (FLT3+++/++) | ||
| Method Description |
The in vivo antitumor activity of ASP1235 was evaluated in a FLT3 positive THP-1 xenograft model. THP-1 cells were subcutaneously inoculated in the right frank of mice at 5 x106 cells/head. The vehicle of each drug is shown as follows: ASP1235 (20 mM Histidine/L-Histidine-HCl, 5.5% trehalose dihydrate, 0.01% Polysorbate 20, pH6.0), venetoclax (60% phosal 50PG, 30% PEG400, 10% ethanol), azacitidine (PBS). ASP1235 was intravenously administrated to each mouse once per week. One day before ASP1235 treatment, each mouse received intraperitoneal injection of 20 mg/kg of nonspecific human IgG1 antibody. Venetoclax was orally administered daily at 100 mg/kg. Azacitidine was intravenously injected at 3 mg/kg for five consecutive days in the first week of treatment.
Click to Show/Hide
|
||||
| In Vivo Model | FLT3-expressing THP-1 xenograft model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | THP-1 cells | CVCL_0006 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
35.10%
|
Positive FLT3 Expression (FLT3+++/++) | ||
| Method Description |
The in vivo antitumor activity of ASP1235 was evaluated in a FLT3 positive THP-1 xenograft model. THP-1 cells were subcutaneously inoculated in the right frank of mice at 5 x106 cells/head. The vehicle of each drug is shown as follows: ASP1235 (20 mM Histidine/L-Histidine-HCl, 5.5% trehalose dihydrate, 0.01% Polysorbate 20, pH6.0), venetoclax (60% phosal 50PG, 30% PEG400, 10% ethanol), azacitidine (PBS). ASP1235 was intravenously administrated to each mouse once per week. One day before ASP1235 treatment, each mouse received intraperitoneal injection of 20 mg/kg of nonspecific human IgG1 antibody. Venetoclax was orally administered daily at 100 mg/kg. Azacitidine was intravenously injected at 3 mg/kg for five consecutive days in the first week of treatment.
Click to Show/Hide
|
||||
| In Vivo Model | FLT3-expressing THP-1 xenograft model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | THP-1 cells | CVCL_0006 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
38%
|
Positive FLT3 Expression (FLT3+++/++) | ||
| Method Description |
The in vivo antitumor activity of ASP1235 was evaluated in a FLT3 positive THP-1 xenograft model. THP-1 cells were subcutaneously inoculated in the right frank of mice at 5 x106 cells/head. The vehicle of each drug is shown as follows: ASP1235 (20 mM Histidine/L-Histidine-HCl, 5.5% trehalose dihydrate, 0.01% Polysorbate 20, pH6.0), venetoclax (60% phosal 50PG, 30% PEG400, 10% ethanol), azacitidine (PBS). ASP1235 was intravenously administrated to each mouse once per week. One day before ASP1235 treatment, each mouse received intraperitoneal injection of 20 mg/kg of nonspecific human IgG1 antibody. Venetoclax was orally administered daily at 100 mg/kg. Azacitidine was intravenously injected at 3 mg/kg for five consecutive days in the first week of treatment.
Click to Show/Hide
|
||||
| In Vivo Model | FLT3-expressing THP-1 xenograft model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | THP-1 cells | CVCL_0006 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) |
84%
|
Positive FLT3 Expression (FLT3+++/++) | ||
| Method Description |
The in vivo antitumor activity of ASP1235 was evaluated in a FLT3 positive THP-1 xenograft model. THP-1 cells were subcutaneously inoculated in the right frank of mice at 5 x106 cells/head. The vehicle of each drug is shown as follows: ASP1235 (20 mM Histidine/L-Histidine-HCl, 5.5% trehalose dihydrate, 0.01% Polysorbate 20, pH6.0), venetoclax (60% phosal 50PG, 30% PEG400, 10% ethanol), azacitidine (PBS). ASP1235 was intravenously administrated to each mouse once per week. One day before ASP1235 treatment, each mouse received intraperitoneal injection of 20 mg/kg of nonspecific human IgG1 antibody. Venetoclax was orally administered daily at 100 mg/kg. Azacitidine was intravenously injected at 3 mg/kg for five consecutive days in the first week of treatment.
Click to Show/Hide
|
||||
| In Vivo Model | FLT3-expressing THP-1 xenograft model | ||||
| In Vitro Model | Childhood acute monocytic leukemia | THP-1 cells | CVCL_0006 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.20-12.00 nM
|
Positive FLT3 Expression (FLT3+++/++) | ||
| Method Description |
The cytotoxic activity of AGS-62P1 was evaluated against a panel of AmL cell lines in vitro.
|
||||
| In Vitro Model | Acute myeloid leukemia | Acute myeloid leukemia cells | Homo sapiens | ||
References
