Antibody Information
General Information of This Antibody (ID: ANTI0SFUKH)
| Antibody Name | Anti-HER2 antibody |
|||||
|---|---|---|---|---|---|---|
| Organization | GeneQuantum Healthcare (Suzhou) Co. Ltd. |
|||||
| Synonyms |
mAb-1
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG1 |
|||||
| Antigen Name | Receptor tyrosine-protein kinase erbB-2 (ERBB2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECGALPETGG Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
Half Maximal inhibitory Concentration (lC50)
|
0.2565
|
nM
|
SK-BR-3 cells | CVCL_0033 | ||
|---|---|---|---|---|---|---|
| Antigen Expression | Positive HER2 expression (HER2+++/++) | |||||
| Antibody Function | anti-HER2 antibody bound to SK-BR-3 cells | |||||
| Antibody Antigen Binding Assay | ErbB2/ HER2-positive human tumor cells such as SK-BR-3 and HCC1954 and MDA-MB-468 ErbB2/ HER2-negative human tumor cells were selected. mAb-1 at different concentrations (10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015, 0.00051nM) Or different concentrations of MMAE (monomethyloratin E) (30, 10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015nM); The ErbB2/HER2 negative cells cultured overnight were added with ADC-1 or antibody mAb-1 at different concentrations (100, 10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015nM) Or different concentrations of MMAE (30, 10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015nM); Puromycin with a final concentration of 5uM was added to the control group. Continue warming at 37°C for 72~120h. 3) Remove the cell plates from the 37°C cell incubator and balance for about 30 minutes to room temperature. Each well is supplemented with 100uLCellTiter Glo reagent, the oscillator oscillates for 2min and then stands at room temperature for 10min away from light. The luminescence value (RLU) is measured. | |||||
| Antibody Activity Information 2 | [1] | |||||
|
Half Maximal inhibitory Concentration (lC50)
|
0.4251
|
nM
|
NCI-N87-CLDN18.2 cells | CVCL_1603 | ||
| Antigen Expression | Positive HER2 expression (HER2+++/++) | |||||
| Antibody Function | anti-HER2 antibody bound to NCI-N87 cells | |||||
| Antibody Antigen Binding Assay | The ErbB2/HER2 positive cells were cultured overnight with ADC-1 or antibody mAb-1 at different concentrations (10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015, 0.00051nM) Or different concentrations of MMAE (monomethyloratin E) (30, 10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015nM); The ErbB2/HER2 negative cells cultured overnight were added with ADC-1 or antibody mAb-1 at different concentrations (100, 10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015nM) Or different concentrations of MMAE (30, 10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015nM); Puromycin with a final concentration of 5uM was added to the control group. Continue warming at 37°C for 72~120h. 3) Remove the cell plates from the 37°C cell incubator and balance for about 30 minutes to room temperature. Each well is supplemented with 100uLCellTiter Glo reagent, the oscillator oscillates for 2min and then stands at room temperature for 10min away from light. The luminescence value (RLU) is measured. | |||||
| Antibody Activity Information 3 | [1] | |||||
|
Half Maximal inhibitory Concentration (lC50)
|
0.6093
|
nM
|
BT474-HDR cells | CVCL_0179 | ||
| Antigen Expression | Positive HER2 expression (HER2+++/++) | |||||
| Antibody Function | anti-HER2 antibody bound to BT-474 cells | |||||
| Antibody Antigen Binding Assay | The ErbB2/HER2 positive cells were cultured overnight with ADC-1 or antibody mAb-1 at different concentrations (10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015, 0.00051nM) Or different concentrations of MMAE (monomethyloratin E) (30, 10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015nM); The ErbB2/HER2 negative cells cultured overnight were added with ADC-1 or antibody mAb-1 at different concentrations (100, 10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015nM) Or different concentrations of MMAE (30, 10, 3.3, 1.1, 0.37, 0.12, 0.041, 0.014, 0.0046, 0.0015nM); Puromycin with a final concentration of 5uM was added to the control group. Continue warming at 37°C for 72~120h. 3) Remove the cell plates from the 37°C cell incubator and balance for about 30 minutes to room temperature. Each well is supplemented with 100uLCellTiter Glo reagent, the oscillator oscillates for 2min and then stands at room temperature for 10min away from light. The luminescence value (RLU) is measured. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
BB-1701 [Phase 2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
30%
|
|||
| Patients Enrolled |
Key eligibility: Adults (≥18) with advanced/metastatic HER2+ tumors (measurable per RECIST 1.1), ECOG 0-1, life expectancy ≥12 weeks. Major exclusions: active CNS metastases requiring steroids (>10mg prednisone), Grade ≥2 peripheral neuropathy, QTcF >450/470ms (M/F), active ILD/pneumonitis, HIV/HBV/HCV infections, or prior cumulative doxorubicin >360mg/m2. Fresh tumor tissue required for HER2 confirmation.
Click to Show/Hide
|
||||
| Administration Dosage |
BB-1701 will be administered as an intravenous infusion, every 3 weeks or every 4 weeks or every 6 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04257110 | Clinical Status | PHASE1 | ||
| Clinical Description |
A First-in-human, Open Label, Multiple Dose, Dose Escalation and Cohort Expansion Phase I Study to Investigate the Safety, Tolerability, Pharmacokinetics and Antitumor Activities of BB-1701 in Subjects With Locally Advanced/Metastatic HER2 Expressing Solid Tumors
|
||||
| Primary Endpoint |
Primary endpoints include safety evaluation (AEs, SAEs, DLTs) and MTD determination during Cycle 1 (21-day cycles) in HER2-expressing solid tumor patients, with monitoring continuing for up to 2 years to assess BB-1701's safety profile.
|
||||
| Other Endpoint |
Secondary objectives comprise PK characterization (AUC0-inf, Cmax), immunogenicity assessment (ADA incidence), and preliminary anti-tumor activity evaluation (ORR, PFS, DOR) through serial tumor assessments per RECIST 1.1 for up to 2 years.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Disease control rate (DCR) |
60%
|
|||
| Patients Enrolled |
Key eligibility: Adults (≥18) with advanced/metastatic HER2+ tumors (measurable per RECIST 1.1), ECOG 0-1, life expectancy ≥12 weeks. Major exclusions: active CNS metastases requiring steroids (>10mg prednisone), Grade ≥2 peripheral neuropathy, QTcF >450/470ms (M/F), active ILD/pneumonitis, HIV/HBV/HCV infections, or prior cumulative doxorubicin >360mg/m2. Fresh tumor tissue required for HER2 confirmation.
Click to Show/Hide
|
||||
| Administration Dosage |
BB-1701 will be administered as an intravenous infusion, every 3 weeks or every 4 weeks or every 6 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04257110 | Clinical Status | PHASE1 | ||
| Clinical Description |
A First-in-human, Open Label, Multiple Dose, Dose Escalation and Cohort Expansion Phase I Study to Investigate the Safety, Tolerability, Pharmacokinetics and Antitumor Activities of BB-1701 in Subjects With Locally Advanced/Metastatic HER2 Expressing Solid Tumors
|
||||
| Primary Endpoint |
Primary endpoints include safety evaluation (AEs, SAEs, DLTs) and MTD determination during Cycle 1 (21-day cycles) in HER2-expressing solid tumor patients, with monitoring continuing for up to 2 years to assess BB-1701's safety profile.
|
||||
| Other Endpoint |
Secondary objectives comprise PK characterization (AUC0-inf, Cmax), immunogenicity assessment (ADA incidence), and preliminary anti-tumor activity evaluation (ORR, PFS, DOR) through serial tumor assessments per RECIST 1.1 for up to 2 years.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [12] | ||||
| Patients Enrolled |
Key eligibility: Adults (≥18) with HER2-positive/HER2-low metastatic BC (1-3 prior chemo regimens, T-DXd exposed), measurable disease (RECIST 1.1), ECOG 0-1. Major exclusions: active CNS metastases, prior eribulin, Grade ≥2 peripheral neuropathy/ILD, QTcF >470ms, uncontrolled infections (HIV/HBV/HCV exceptions), or LVEF <50%. Tumor tissue must be available for central HER2 confirmation.
Click to Show/Hide
|
||||
| Administration Dosage |
BB-1701 will be administered as an intravenous infusion, every 3 weeks (21-day cycle).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06188559 | Clinical Status | PHASE2 | ||
| Clinical Description |
An Open-label, Multicenter, Phase 2 Dose Optimization and Expansion Study to Evaluate the Safety and Efficacy of BB-1701, an Anti-human Epidermal Growth Factor Receptor 2 (Anti-HER2) Antibody-drug Conjugate (ADC), in Previously Treated Subjects With HER2-positive or HER2-low Unresectable or Metastatic Breast Cancer
|
||||
| Primary Endpoint |
Primary endpoints include comprehensive safety evaluation (AEs, lab abnormalities, vital signs, ECGs, ECOG status) during dose optimization (Part 1, 35 months) and ORR assessment by investigator (Part 1) or BICR (Part 2) per RECIST v1.1 in HER2-positive/HER2-low metastatic breast cancer patients previously treated with T-DXd.
|
||||
| Other Endpoint |
Secondary objectives encompass efficacy measures (DOR, PFS, OS, DCR, CBR, TTR) and detailed PK analysis (Cmax, Tmax, AUC, t1/2, CL, Vss, Ctrough) of BB-1701 components in both parts (35 months), with Part 2 featuring BICR-confirmed assessments and additional safety monitoring identical to Part 1.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [13] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
50.00
70.60 % |
|||
| Patients Enrolled |
Patients with advanced/metastatic HER2-positive solid tumors, who had progressed on, or were intolerant to prior standard therapies, with ECOG PS 2, and measurable disease,.
|
||||
| Administration Dosage |
6 dose levels from 0.40 to 2.60 mg/kg Q3W.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04257110 | Clinical Status | Phase 1 | ||
| Clinical Description |
A first-in-human, open label, multiple dose, dose escalation and cohort expansion phase 1 study to investigate the safety, tolerability, pharmacokinetics and antitumor activities of bb-1701 in subjects with locally advanced/metastatic HER2 expressing solid tumors.
|
||||
TQB2102 [Phase 3]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible participants are HER2+ recurrent/metastatic breast cancer patients (18-75 years, ECOG 0-1) with measurable disease (RECIST 1.1), adequate organ function, and progression after prior therapy. Reproductive-age subjects require contraception for 6 months post-study.
|
||||
| Administration Dosage |
Dose: 6.0 mg/kg or 7.5 mg/kg of TQB2102 for injection. Administration: Intravenous infusion, administered every 3 weeks, 21 days as a treatment cycle.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06115902 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1 Clinical Trial of TQB2102 for Injection in Patients With Human Epidermal Growth Factor Receptor 2 (HER2) -Expressing Relapsed/Metastatic Breast Cancer
|
||||
| Primary Endpoint |
Primary efficacy endpoint is ORR (CR+PR rate) assessed over 10 months, with safety monitoring including AE incidence/severity tracked from consent through 28 days post-treatment or new therapy initiation.
|
||||
| Other Endpoint |
Secondary outcomes include survival metrics (PFS up to 14 months, OS up to 20 months), disease activity measures (DOR/DCR/CBR), and PK/immunogenicity profiles (TQB2102 concentration, ADA development) evaluated through serial sampling across treatment cycles (21-day intervals).
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Eligible participants are treatment-naïve HER2+ invasive breast cancer patients (T0-4/N0-3/M0) with ECOG 0-1, adequate organ function, and surgical eligibility post-neoadjuvant therapy. Reproductive-age subjects require contraception for 6 months post-study, confirmed by pregnancy testing.
|
||||
| Administration Dosage |
TQB2102 for injection is a HER2 dual-antibody-drug Conjugate (ADC), 6.0 mg/kg or 7.0 mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06198751 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase 2, Randomized, Open-label, Multicenter Study to Evaluate the Efficacy and Safety of TQB2102 for Injection for Neoadjuvant Treatment of Breast Cancer With Positive HER2 Expression
|
||||
| Primary Endpoint |
Primary endpoints include pathological response rates (tpCR and bpCR) assessed within 12 months, evaluating complete tumor disappearance in breast tissue and lymph nodes, alongside comprehensive AE monitoring (incidence/severity per NCI CTCAE v5.0) from consent through 28 days post-treatment.
|
||||
| Other Endpoint |
Secondary outcomes measure efficacy via ORR (12 months), long-term survival (EFS/IDFS up to 60 months tracking recurrence and mortality), and immunogenicity (ADA incidence) through multi-cycle testing (21-day intervals) until 90 days post-treatment
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Eligible participants are HER2-negative recurrent/metastatic breast cancer patients (18-75 years, ECOG ≤1) with progression after ≥1 line of chemotherapy (or CDK4/6 inhibitors for HR+ cases), measurable lesions (RECIST 1.1), and available tumor samples. Reproductive-age subjects require contraception for 6 months post-study with confirmed negative pregnancy testing.
Click to Show/Hide
|
||||
| Administration Dosage |
7.5mg/kg TQB2102, intravenous infusion, administered every 3 weeks, 21 days as a treatment cycle.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06452706 | Clinical Status | PHASE2 | ||
| Clinical Description |
The Phase II Clinical Trial to Evaluate the Efficacy and Safety of TQB2102 for Injection in Human Epidermal Growth Factor Receptor 2 (HER2) Negative Recurrent/Metastatic Breast Cancer
|
||||
| Primary Endpoint |
Primary efficacy endpoint is ORR (CR+PR rate per RECIST 1.1) assessed over 24 months, with comprehensive safety monitoring including AE incidence tracked for 36 months and ADA development evaluated through multi-cycle testing (21-day intervals) until 30 days post-treatment.
|
||||
| Other Endpoint |
Secondary outcomes include survival metrics (PFS up to 36 months, OS up to 48 months), disease activity measures (duration of remission/DCR/CBR), and biomarker analyses (HER2 expression correlation, ctDNA dynamics) all evaluated within 24 months.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [6] | ||||
| Patients Enrolled |
Eligible participants are treatment-compliant adults (18-75 years, ECOG 0-1) with confirmed unresectable HER2-low breast cancer (HR status documented), radiologically proven progression, ≥1 measurable lesion (RECIST 1.1), and adequate organ function.
|
||||
| Administration Dosage |
Administered by intravenous drip, 7.5 mg/kg per dose, 21 days as a treatment cycle.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06561607 | Clinical Status | PHASE3 | ||
| Clinical Description |
A Randomized, Open, Parallel-Controlled Phase III Clinical Trial Evaluating the Efficacy and Safety of TQB2102 for Injection Versus Investigator-Selected Chemotherapy in HER2 Low-Expressing Recurrent/Metastatic Breast Cancer
|
||||
| Primary Endpoint |
The primary endpoint is IRC-assessed PFS (up to 25 months) comparing TQB2102 versus chemotherapy in both HR+/HER2-low and overall HER2-low recurrent/metastatic breast cancer populations.
|
||||
| Other Endpoint |
Secondary endpoints include investigator-assessed efficacy measures (PFS/OS/ORR/DOR/CBR) within 25 months, safety monitoring (AE/SAE incidence, lab abnormalities) for 52 months, PK analysis of TQB2102 components during treatment cycles, and ADA immunogenicity assessment at specified intervals.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [7] | ||||
| Patients Enrolled |
Eligible patients (18-75 years, ECOG 0-1) must have signed consent, locally advanced HER2+ solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST 1.1), adequate organ function, and commitment to contraception for 6 months post-treatment.
|
||||
| Administration Dosage |
intravenous infuse TQB2102 injection every three weeks, 21 days as a treatment cycle. (1.5mg/kg, 3mg/kg, 4.5mg/kg, 6mg/kg, 7.5mg/kg, 9mg/kg)
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05735496 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Study of TQB2102 Injection in Patients With Advanced Cancers
|
||||
| Primary Endpoint |
Primary endpoints include DLT assessment during first 21-day cycle to determine MTD, with comprehensive AE monitoring (incidence/severity per NCI CTCAE v5.0) from first dose until 28 days post-treatment or new therapy initiation.
|
||||
| Other Endpoint |
Secondary outcomes comprise immunogenicity (ADA incidence across treatment cycles), PK parameters (AUC/Cmax/T1/2 for ADC components), and efficacy measures (ORR/DCR/DOR/PFS/OS) evaluated over 2 years per RECIST v1.1 criteria.
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [8] | ||||
| Patients Enrolled |
Eligible subjects (18-75 years, ECOG 0-1) must have histologically confirmed unresectable/metastatic biliary cancer with ≥1 measurable lesion (RECIST 1.1), adequate organ function, failed prior therapy, and reproductive-age patients must use contraception for 6 months post-study.
|
||||
| Administration Dosage |
Intravenous infusion, administered every 3 weeks, 21 days as a treatment cycle, 6/8 cycles.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06431490 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Study to Evaluate the Efficacy, Safety, and Immunogenicity of TQB2102 for Injection in the Treatment of HER2-positive Locally Advanced or Metastatic Biliary Tract Cancer
|
||||
| Primary Endpoint |
Primary endpoints include AE/SAE incidence and severity monitoring from informed consent until 28 days post-treatment, along with RP2D determination within 24 weeks.
|
||||
| Other Endpoint |
Secondary efficacy measures (ORR/PFS/DCR/DOR/OS) will be investigator-assessed per RECIST 1.1 over 36 weeks in HER2-positive (IHC 3+ or 2+/ISH+) advanced biliary tract cancer patients.
|
||||
| Experiment 7 Reporting the Activity Date of This ADC | [9] | ||||
| Patients Enrolled |
Eligible patients (18-75 years, ECOG 0-1) must have confirmed HER2+ (IHC 3+ or 2+/ISH+) unresectable/metastatic gastroesophageal adenocarcinoma, ≥1 measurable lesion (RECIST 1.1), adequate organ function, and no prior systemic therapy for metastatic disease (except adjuvant/neoadjuvant completed ≥6 months prior). PD-L1 testing capability and contraception use for 6 months post-treatment are required.
Click to Show/Hide
|
||||
| Administration Dosage |
TQB2102 for injection in combination with benmelstobart every three weeks for a cycle of 21 days
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06767800 | Clinical Status | PHASE2 | ||
| Clinical Description |
Phase II Clinical Trial Evaluating the Efficacy and Safety of TQB2102 for Injection in Chemotherapy With Behmosubstituted Monoclonalb/Pembrolizumab ± Capecitabine in Patients With Unresectable, Locally Advanced, Recurrent, or Metastatic HER2-Positive Gastroesophageal Adenocarcinoma
|
||||
| Primary Endpoint |
The primary endpoint is ORR (CR+PR) assessed by both RECIST v1.1 and iRECIST criteria over an average 1-year study period in HER2-positive gastroesophageal adenocarcinoma patients.
|
||||
| Other Endpoint |
Secondary endpoints include PFS (average 3 years), DOR (average 1 year), OS (average 3 years), and AE/SAE incidence (CTCAE v5.0) monitored until 28 days post-treatment.
|
||||
| Experiment 8 Reporting the Activity Date of This ADC | [10] | ||||
| Patients Enrolled |
Eligible subjects are female (≥18 years, ECOG 0-1) with histologically confirmed recurrent/metastatic gynecologic tumors (excluding IHC 0), ≥1 measurable lesion (RECIST 1.1), and premenopausal women must use high-efficacy contraception (failure rate <1%/year) with negative pregnancy testing at screening.
|
||||
| Administration Dosage |
Intravenous infusion, administered every 3 weeks, 21 days as a treatment cycle
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06798207 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase 2 Clinical Trial of TQB2102 for Injection in the Treatment of Patients With Recurrent/Metastatic Advanced Gynecological Tumors to Evaluate the Safety and Efficacy
|
||||
| Primary Endpoint |
The primary endpoint is ORR (CR+PR rate) evaluated over 12 months in patients with HER2-expressing (IHC 1+/2+/3+) advanced gynecologic tumors who failed prior platinum-based chemotherapy.
|
||||
| Other Endpoint |
Secondary endpoints include DOR/PFS/DCR (12-month assessment), OS (17-month follow-up), AE frequency/severity monitoring from consent to 28 days post-treatment, and ADA incidence at specified treatment cycles (21-day intervals).
|
||||
| Experiment 9 Reporting the Activity Date of This ADC | [11] | ||||
| Patients Enrolled |
Eligible subjects must have histologically confirmed unresectable NSCLC, failed prior therapy, life expectancy ≥3 months, and reproductive-age patients require contraception for 6 months post-study with negative pregnancy testing at screening.
|
||||
| Administration Dosage |
TQB2102 for injection, intravenous infusion, administered every 3 weeks, 21 days as a treatment cycle; Benmelstobart injection, intravenous infusion, administered every 3 weeks, 21 days as a treatment cycle.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06496490 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase 2 Clinical Trial of TQB2102 for Injection in Locally Advanced or Metastatic Non-small Cell Lung Cancer With HER2 Gene Abnormality to Evaluate the Efficacy and Safety
|
||||
| Primary Endpoint |
Primary endpoint is ORR (CR+PR rate) assessed over 8 months in treatment-refractory NSCLC patients (18-75 years, ECOG 0-1) with measurable lesions (RECIST 1.1).
|
||||
| Other Endpoint |
Secondary outcomes include DOR/PFS (8-month assessment), OS (18-month follow-up), AE frequency/severity monitoring until 28 days post-treatment, and ADA incidence at treatment cycles (C1D1-C12D1) plus 90-day follow-up.
|
||||
| Experiment 10 Reporting the Activity Date of This ADC | [14] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05735496 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study of TQB2102 injection in patients with advanced cancers.
|
||||
BL-M17D1 [Phase 1]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [15] | ||||
| Patients Enrolled |
Inclusion: Signed consent, age 18-75 (Ia) or ≥18 (Ib), HER2+/- solid tumors, measurable lesions (RECIST 1.1), ECOG 0-1, adequate organ function. Exclusion: Recent antitumor therapy, uncontrolled comorbidities (cardiac, autoimmune, infections), CNS metastases, allergies to BL-M17D1, pregnancy, or investigator-assessed ineligibility.
|
||||
| Administration Dosage |
Participants receive BL-M17D1 as intravenous infusion for the first cycle (3 weeks). Participants with clinical benefit could receive additional treatment for more cycles. The administration will be terminated because of disease progression or intolerable toxicity occurring or other reasons.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06500052 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Study to Evaluate the Safety, Tolerability, Pharmacokinetic Characteristics and Preliminary Efficacy of BL-M17D1 in Patients With Locally Advanced or Metastatic HER2 Positive/Lower Expression Gastrointestinal Cancer and Other Solid Tumors
|
||||
| Primary Endpoint |
Phase Ia assesses DLTs (NCI-CTCAE v5.0) and MTD (highest dose with ≤1/6 DLTs) within 21 days post-first dose. Phase Ib determines RP2D (within ~24 months) based on integrated safety, efficacy, PK, and PD data.
|
||||
| Other Endpoint |
TEAEs (type/frequency/severity) and PK parameters (Cmax, Tmax, T1/2, AUC0-t, CL, Ctrough) are monitored for ~24 months. Immunogenicity (ADA) and efficacy (ORR, DCR per RECIST 1.1; DOR) are evaluated in Phase Ib.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [16] | ||||
| Patients Enrolled |
Inclusion: Signed consent, age ≥18, HER2+/- solid tumors, measurable lesions (RECIST 1.1), ECOG 0-1, adequate organ function. Exclusion: Recent antitumor therapy, uncontrolled comorbidities (cardiac, autoimmune, infections), CNS metastases, allergies to BL-M17D1, pregnancy, or investigator-assessed ineligibility.
|
||||
| Administration Dosage |
The study includes 3 parts: Part 1 Dose escalation. Part 2 Dose Finding non-randomized and Part 3 Dose expansion randomized. BL-M17D1 will be administered on Day 1 via by intravenous infusion every 3 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06714617 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1 Open-Label Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of BL-M17D1 in Subjects with HER2-Expressing or HER2-Mutant Advanced or Metastatic Solid Tumors
|
||||
| Primary Endpoint |
The study evaluates dose-limiting toxicities (DLTs) including hematologic (Grade 4 neutropenia >7 days, febrile neutropenia ≥Grade 3) and nonhematologic toxicities (Grade ≥3 events, Hy's law cases) over 1 year. MTD, MAD, and RDEs of BL-M17D1 will be determined, alongside monitoring of SAEs and TEAEs.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [17] | ||||
| Patients Enrolled |
Inclusion: Signed consent, age 18-75 (Ia) or ≥18 (Ib), HER2+/- solid tumors, measurable lesions (RECIST 1.1), ECOG 0-1, adequate organ function. Exclusion: Recent antitumor therapy, uncontrolled comorbidities (cardiac, autoimmune, infections), CNS metastases, allergies to BL-M17D1, pregnancy, or investigator-assessed ineligibility.
|
||||
| Administration Dosage |
Participants receive BL-M17D1 as intravenous infusion for the first cycle (3 weeks). Participants with clinical benefit could receive additional treatment for more cycles. The administration will be terminated because of disease progression or intolerable toxicity occurring or other reasons.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06503783 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Study to Evaluate the Safety, Tolerability, Pharmacokinetic Characteristics and Preliminary Efficacy of BL-M17D1 in Patients With Locally Advanced or Metastatic HER2 Positive/Negative Breast Cancer and Other Solid Tumors
|
||||
| Primary Endpoint |
Phase Ia evaluates DLTs (NCI-CTCAE v5.0) and MTD (highest dose with ≤1/6 DLTs) within 21 days post-first dose. Phase Ib determines RP2D (up to 24 months) based on integrated safety, efficacy, PK, and PD data.
|
||||
| Other Endpoint |
TEAEs (type/frequency/severity) and PK parameters (Cmax, Tmax, T1/2, AUC0-t, CL, Ctrough) are monitored for 24 months. Immunogenicity (ADA) and efficacy (ORR/DCR per RECIST 1.1, DOR) are assessed in Phase Ib.
|
||||
BAT8010 [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [18] | ||||
| Patients Enrolled |
Eligibility requires ECOG 0-1, HER2-expressing tumors (IHC3+/2+), measurable lesions (RECIST 1.1), and adequate organ function. Key exclusions include prior HER2-targeted therapy with grade ≥3 toxicity, uncontrolled CNS metastases, major surgery <28 days, active HBV/HCV/syphilis infection, NYHA II-IV heart failure, interstitial lung disease, or pregnancy. Recent anti-tumor therapies (<28 days) or radiopharmaceuticals (<8 weeks) are prohibited, with investigator discretion for other compromising conditions.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05848466 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, Open-label Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Preliminary Efficacy of BAT8010 for Injection in Patients With Advanced or Metastatic Solid Tumors
|
||||
| Primary Endpoint |
The study defines dose-limiting toxicity (DLT) as grade 5 toxicity, grade 4 hepatotoxicity (ALT/AST >5xULN with bilirubin elevation), prolonged grade 4 hematologic toxicities (>7 days), febrile neutropenia, or any grade ≥3 non-hematologic toxicity. The maximum tolerated dose (MTD) is identified as the highest dose where DLTs occur in ≤1/6 subjects within the 3-week evaluation period.
Click to Show/Hide
|
||||
| Other Endpoint |
Pharmacokinetic analysis monitors Cmax per 3-week cycle up to 18 weeks, while immunogenicity tracks ADA/NAb levels throughout treatment (cycles 1-18 weekly, then every 4 cycles up to 1 year). Efficacy endpoints include ORR (CR+PR rates at 18 weeks and overall), DoR (response duration until progression/death), DCR (CR+PR+SD), PFS (time to progression/death), and OS (time to death from any cause) over a 2-year average follow-up.
Click to Show/Hide
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [19] | ||||
| Patients Enrolled |
Eligible patients must be ≥18 years with ECOG 0-1, HER2-positive tumors (IHC3+/2+ ± FISH), measurable lesions (RECIST 1.1), and adequate organ function. Key exclusions: prior HER2-targeted therapy with grade ≥3 toxicity/LVEF <50%, uncontrolled CNS metastases, major surgery (<28 days), active infections (HBV/HCV/syphilis), NYHA II-IV cardiac dysfunction, or interstitial lung disease. Prohibited concurrent therapies include recent anti-tumor treatments (<28 days), radiopharmaceuticals (<8 weeks), and pregnancy/lactation, with investigator discretion for other high-risk conditions affecting compliance.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06376136 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
An Evaluation of BAT 8010 for Injection in Combination With BAT 1006 in Locally Advanced or Metastatic Entities Safety, Tolerability, Pharmacokinetic Profile, and Initial Clinical Efficacy of the Tumor in Patients Multicenter, Open Phase Ib/IIa Clinical Study
|
||||
| Primary Endpoint |
Safety assessments include monitoring dose-limiting toxicities (DLT) during the first 21-day cycle, tracking abnormal vital signs (including blood pressure, pulse, temperature), physical examinations, adverse events (AEs) from first dose until 28 days post-treatment or new therapy initiation, and clinical lab abnormalities (hematology, biochemistry) over 1 year, alongside efficacy metrics like duration of response (DOR) and disease control rate (DCR) tracking tumor response stability and shrinkage.
Click to Show/Hide
|
||||
| Other Endpoint |
Pharmacokinetic profiling evaluates Cmax, Tmax, clearance rate (CL), and half-life (T1/2) at multiple timepoints across cycles 1-6 and end-of-treatment (17 cycles of 2 weeks each). Immunogenicity testing measures anti-drug antibodies (ADA) and neutralizing antibodies (NAb) at cycle starts (cycles 1-3, 5-6) and EOT to assess drug exposure and immune response patterns over the treatment trajectory.
Click to Show/Hide
|
||||
References
