Antibody Information
General Information of This Antibody (ID: ANTI0SFTSA)
| Antibody Name | Anti-TROP2 antibody |
|||||
|---|---|---|---|---|---|---|
| Organization | ASTRAZENECA UK LIMITED | DAIICHI SANKYO COMPANY |
|||||
| Synonyms |
anti-TROP2 antibody
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG1 |
|||||
| Antigen Name | Tumor-associated calcium signal transducer 2 (TACSTD2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
MKHLWFFLLLVAAPRWVLSQVQLVQSGAEVKKPGASVKVSCKASGYTFTTAGMQWVRQAP
GQGLEWMGWINTHSGVPKYAEDFKGRVTISADTSTSTAYLQLSSLKSEDTAVYYCARSGF GSSYWYFDVWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVS WNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRYVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
QVQLVQSGAEVKKPGASVKVSCKASGYTFTTAGMQWVRQAPGQGLEWMGWINTHSGVPKY
AEDFKGRVTISADTSTSTAYLQLSSLKSEDTAVYYCARSGFGSSYWYFDVWGQGTLVTVS S Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
TAGMQ
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
WINTHSGVPKYAEDFKG
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
SGFGSSYWYFDV
Click to Show/Hide
|
|||||
| Light Chain Sequence |
MVLQTQVFISLLLWISGAYGDIQMTQSPSSLSASVGDRVTITCKASQDVSTAVAWYQQKP
GKAPKLLIYSASYRYTGVPSRFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGQ GTKLEIKRTVAAPSVFIFPPSDEQLKSGTASYVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHGGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DIQMTQSPSSLSASVGDRVTITCKASQDVSTAVAWYQQKPGKAPKLLIYSASYRYTGVPS
RFSGSGSGTDFTLTISSLQPEDFAVYYCQQHYITPLTFGQGTKLEIKRT Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
KASQDVSTAVA
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
SASYRYT
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
QQHYITPLT
Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Sacituzumab drozuntecan [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
30.40%
|
|||
| Patients Enrolled |
Eligible patients (≥18 years, ECOG 0-1, measurable lesions, LVEF≥50%) must provide tumor samples for biomarker analysis; exclusions include active cardiac/ILD conditions, uncontrolled infections, AIDS-defining HIV illness, or QTcF>470ms.
|
||||
| Administration Dosage |
In Ph1, DB-1305 was planned to be administered from 2 mg/kg to 8 mg/kg (Q3W, iv) in a 3+3 design with accelerated titration for the starting dose; additional pts were enrolled to determine the recommended phase 2 dose (RP2D).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05438329 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase 1/2a, Multicenter, Open-Label, First in Human Study to Assess the Safety, Tolerability, Pharmacokinetics, and Preliminary Antitumor Activity of DB-1305 in Subjects with Advanced/Metastatic Solid Tumors
|
||||
| Primary Endpoint |
Phase 1 evaluates DLTs within 21 days of initial dosing and monitors TEAEs/SAEs up to 30 days post-treatment, determining MTD and RP2D of DB-1305/BNT325 over ~12 months; Phase 2a assesses safety (TEAEs/SAEs) and efficacy (ORR) using RECIST 1.1 until disease progression or ~12 months.
|
||||
| Other Endpoint |
Efficacy measures (ORR, DCR, TTR, PFS, OS) and PK parameters (AUC, Cmax, Tmax, Ctrough) are evaluated over 8 cycles (21-day cycles), with immunogenicity assessed via ADA prevalence/incidence during treatment for both Phase 1 and 2a cohorts.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Disease control rate (DCR) |
87%
|
|||
| Patients Enrolled |
Eligible patients (≥18 years, ECOG 0-1, measurable lesions, LVEF≥50%) must provide tumor samples for biomarker analysis; exclusions include active cardiac/ILD conditions, uncontrolled infections, AIDS-defining HIV illness, or QTcF>470ms.
|
||||
| Administration Dosage |
In Ph1, DB-1305 was planned to be administered from 2 mg/kg to 8 mg/kg (Q3W, iv) in a 3+3 design with accelerated titration for the starting dose; additional pts were enrolled to determine the recommended phase 2 dose (RP2D).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05438329 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase 1/2a, Multicenter, Open-Label, First in Human Study to Assess the Safety, Tolerability, Pharmacokinetics, and Preliminary Antitumor Activity of DB-1305 in Subjects with Advanced/Metastatic Solid Tumors
|
||||
| Primary Endpoint |
Phase 1 evaluates DLTs within 21 days of initial dosing and monitors TEAEs/SAEs up to 30 days post-treatment, determining MTD and RP2D of DB-1305/BNT325 over ~12 months; Phase 2a assesses safety (TEAEs/SAEs) and efficacy (ORR) using RECIST 1.1 until disease progression or ~12 months.
|
||||
| Other Endpoint |
Efficacy measures (ORR, DCR, TTR, PFS, OS) and PK parameters (AUC, Cmax, Tmax, Ctrough) are evaluated over 8 cycles (21-day cycles), with immunogenicity assessed via ADA prevalence/incidence during treatment for both Phase 1 and 2a cohorts.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [9] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05438329 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
A phase 1/2a, multicenter, open-label, non-randomized first in human study to assess the safety, tolerability, pharmacokinetics, and preliminary antitumor activity of DB-1305 in subjects with advanced/metastatic solid tumors.
|
||||
9MW2921 [Phase 1/2 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Key inclusion criteria: Age 18-75; ECOG 0-1; histologically confirmed advanced/metastatic malignancies refractory to standard therapy; ≥1 measurable lesion; adequate organ function; provision of tumor samples (≥5 slides); negative pregnancy test; commitment to contraception (6 months post-treatment); protocol compliance capability. Survival expectancy ≥3 months.
Click to Show/Hide
|
||||
| Administration Dosage |
All subjects will receive 9MW2921 by intravenous (IV) every 3 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05990452 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase I/II First-in-human Study of 9MW2921 to Evaluate the Safety, Tolerability and Preliminary Efficacy of 9MW2921 in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
Primary endpoints include DLT assessment (21 days post-first dose), AE/SAE incidence (up to 2 years), and ORR (CR+PR rate per RECIST 1.1, monitored for 2 years or until treatment discontinuation).
|
||||
| Other Endpoint |
Secondary endpoints comprise PK parameters (Cmax/AUC/t½ over 1 year), ADA development (2 years), and efficacy measures (PFS/DoR/DCR per RECIST 1.1, tracked for 2 years or until progression/death).
|
||||
GQ1010 [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Key eligibility: Adults (≥18) with advanced solid tumors (RECIST 1.1 measurable, ECOG 0-1) refractory to standard therapies, requiring adequate organ function. Exclusions: active brain metastases, ILD history, prior Trop-2 therapy, or combination-specific contraindications (e.g., cemiplimab hypersensitivity, Grade 3+ immune-related AEs). Pregnancy and recent anticancer therapies/surgeries are prohibited.
Click to Show/Hide
|
||||
| Administration Dosage |
BHV-1510 will be administered as an IV infusion on Day 1 every 3 weeks
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06384807 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase 1/2, First in Human, Dose Escalation and Dose Expansion Study of BHV-1510 (Previously PBI-410) as Monotherapy and in Combination With Anti-Cancer Agents in Participants With Advanced Solid Tumors
|
||||
| Primary Endpoint |
Primary endpoints assess safety (AE/SAE/DLT incidence per NCI CTCAE v5.0) and dose determination (RDE/MTD) for BHV-1510 monotherapy and combination with cemiplimab in Phase 1, while Phase 2 focuses on ORR per RECIST 1.1 for monotherapy, all evaluated over approximately 47 months.
|
||||
| Other Endpoint |
Secondary objectives include PK parameters (Cmax/AUC/t1/2 within 22 days), immunogenicity (ADA incidence), and efficacy metrics (DOR in Phase 1; DCR/PFS/OS in Phase 2 monotherapy), with tumor response assessed via RECIST 1.1 across both phases.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Key eligibility: Adults (≥18) with advanced epithelial solid tumors (RECIST 1.1 measurable, ECOG 0-1) refractory to standard therapies, requiring adequate organ function. Exclusions: active infections (HBV/HCV/HIV), severe comorbidities (cardiac/pulmonary/ocular), prior Trop-2/TOP1-ADC therapy, or unresolved Grade 2+ toxicities. Tumor types prioritized include gastric/breast/colorectal cancers.
Click to Show/Hide
|
||||
| Administration Dosage |
GQ1010 will be administered intravenously every 21 days or every 14 days. Dose Escalation will be guided by Bayesian Optimal Interval (BOIN) Design.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06464055 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase I/II, Multicenter, Open-Label, Dose-Escalation and Extension Study of GQ1010 (an Anti-Trop2 ADC) in Subjects With Advanced Solid Tumors
|
||||
| Primary Endpoint |
Primary endpoints evaluate safety (AE/SAE/DLT incidence per NCI-CTCAE v5.0) and dose determination (MTD/RDE/RP2D) in Phase Ia/Ib, while Phase II focuses on ORR per RECIST 1.1, all assessed over approximately 1 year.
|
||||
| Other Endpoint |
Secondary objectives include PK parameters (Cmax/Tmax/AUC/t1/2), immunogenicity (ADA), and efficacy metrics (ORR/DOR/DCR/PFS/OS per RECIST 1.1), with tumor response requiring confirmed CR/PR assessments.
|
||||
MHB036C [Phase 2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Eligible participants (≥18 years, ECOG 0-1) must have advanced solid tumors (e.g., NSCLC, SCLC, PDAC) failing prior therapies, measurable lesions (RECIST v1.1/PCWG3), and adequate organ function (ANC≥1.5×10<sup>9</sup>/L, platelets≥100×10<sup>9</sup>/L, LVEF≥50%). Key exclusions: active CNS metastases, prior same-target therapy, uncontrolled infections (HBV-DNA+/HCV-RNA+), QTcF>450/470ms, immunosuppressive steroid use, or live vaccinations within 4 weeks. NSCLC/SCLC/UC subgroups require prior platinum/ICI failure.
Click to Show/Hide
|
||||
| Administration Dosage |
MHB036C will be administered intravenously at a frequency of once every 3 weeks (Q3W).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05642949 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
Phase 1/2, Multi-center, Open-label, Dose Escalation and Cohort Expansion Study to Evaluate the Safety/Tolerability, Pharmacokinetics and Efficacy of MHB036C in Participants With Advanced or Metastatic Solid Tumors
|
||||
| Primary Endpoint |
Safety endpoints include adverse events (CTCAE v5.0) monitoring from first MHB036C dose through 30 days post-treatment and dose-limiting toxicities (DLTs) assessed within 21 days after initial administration.
|
||||
| Other Endpoint |
Pharmacokinetic parameters (Cmax, Tmax, AUC, Ctrough, t1/2, CL) will be evaluated over 5 treatment cycles (21-day cycles) for MHB036C components. Immunogenicity (ADA) and efficacy outcomes (ORR, DOR, DCR, PFS per RECIST v1.1) will be tracked for 24 months.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [6] | ||||
| Patients Enrolled |
Eligible participants (≥18 years, ECOG 0-1) must have treatment-refractory metastatic solid tumors, adequate organ function, and use contraception. Key exclusions include multiple malignancies (5-year window), recent anti-cancer therapies (chemotherapy within 3 weeks, brain metastases unless stable ≥4 weeks), prior same-target therapy, or unresolved toxicities (>CTCAE grade 1).
Click to Show/Hide
|
||||
| Administration Dosage |
MHB036C IV every 3 weeks
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06373406 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase I/II, Dose Escalation and Dose Expansion Study of MHB036C for Advanced Solid Tumor to Evaluate the Tolerability/Safety, Pharmacokinetics and Efficacy
|
||||
| Primary Endpoint |
The study evaluates safety through incidence of adverse events (AEs) monitored until 30 days post-treatment and dose-limiting toxicities (DLTs) defined as MHB036C-related toxicities meeting severity criteria within the first 21-day cycle.
|
||||
| Other Endpoint |
Pharmacokinetic analysis includes maximum plasma concentration (Cmax) and AUC calculation from serum concentrations, alongside immunogenicity assessment via anti-drug antibody (ADA) detection. Efficacy is measured by objective response rate (ORR) per RECIST 1.1, tracking complete/partial responses until 30 days post-treatment.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [8] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05642949 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
Phase 1/2, multi-center, open-label, dose escalation and cohort expansion study to evaluate the safety/tolerability, pharmacokinetics and efficacy of MHB036C in participants with advanced or metastatic solid tumors.
|
||||
BIO-106 [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [7] | ||||
| Patients Enrolled |
Eligible patients must have advanced/metastatic solid tumors with disease progression post-standard therapy, measurable disease (RECIST 1.1 or bone-only), and ECOG 0-1. Exclusions cover drug hypersensitivity, cardiac dysfunction, active infections (HIV/HBV/HCV/SARS-CoV-2), and untreated CNS metastases.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05320588 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase 1/2 Study of BIO-106 As Monotherapy or In Combination With Pembrolizumab in Patients With Advanced Cancers (StarBridge-1)
|
||||
| Primary Endpoint |
The Phase 1 escalation period assesses safety (AEs, SAEs, DLTs) over 1 year to determine MTD, while the Phase 2 expansion period evaluates anti-tumor activity through ORR, DCR, DOR, PFS, and OS over 2 years.
|
||||
| Other Endpoint |
Phase 1 measures anti-tumor activity (ORR, DCR, DOR, PFS, OS) over 1 year, while Phase 2 monitors AESIs and AEs/SAEs over 2 years. PK parameters (Cmax, AUC) and anti-drug antibodies for BIO-106 are tracked across both phases.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [10] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05320588 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
A phase 1/2 study of BIO-106 as monotherapy or in combination with pembrolizumab in patients with advanced cancers (starbridge-1).
|
||||
FZ-AD004 [Phase 1]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [11] | ||||
| Patients Enrolled |
This study is one single group of participants with advanced solid tumors.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05914545 | Clinical Status | Phase 1 | ||
| Clinical Description |
This study is one single group of participants with advanced solid tumors. It is the first time the drug has been used in humans. There will be two parts including Dose Escalation and Dose Expansion to evaluate the safety, tolerability, pharmacokinetics, and clinical activity of FZ-AD004.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [16] | ||||
| Patients Enrolled |
Eligible patients (aged 18-75, ECOG 0-1) must have advanced solid tumors, measurable lesions per RECIST 1.1, and ≥12-week life expectancy. Exclusions include recent major surgery (within 4 weeks), active CNS metastases, prior malignancies (5 years), steroid use (within 2 weeks), pregnancy/lactation, or conditions compromising study integrity. Contraception is required during and post-treatment.
Click to Show/Hide
|
||||
| Administration Dosage |
Dose Escalation:Subjects will receive an intravenous infusion of FZ-AD004 in a dose escalation until confirmed progression, unaccepted toxicity, or any criterion for withdrawal from the study. Dose Expansion:Subject will receive a single dose of FZ-AD004 at 1-2 dose level on Day1 of each cycles.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05914545 | Clinical Status | PHASE1 | ||
| Clinical Description |
A PhaseIStudy to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of FZ-AD004 in Patients with Advanced Solid Tumors
|
||||
| Primary Endpoint |
The primary objectives are to assess DLT (within 21 days of first cycle), determine MTD/RDEs, and monitor AE incidence throughout the trial. Secondary efficacy endpoints include ORR (CR + PR per RECIST 1.1), PFS (time from first dose to PD/death), DoR (response duration from CR/PR to PD), and OS (time from first dose to death), evaluated over 60 months.
Click to Show/Hide
|
||||
| Other Endpoint |
Pharmacokinetic analyses focus on t1/2, Cmax, AUC (0-∞), and Tmax measurements for Total Antibody, Free DXd, and FZ-AD004 over 17 weeks. Immunogenicity is assessed via ADA detection. Key efficacy outcomes include PFS (time to PD/death), DoR (duration of response), and OS (time to death), all evaluated over 60 months per RECIST 1.1.
|
||||
BAT8008 [Phase 2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [12] | ||||
| Patients Enrolled |
Eligible patients are adults (≥18 years) with histologically confirmed advanced/metastatic solid tumors refractory to standard therapy, measurable lesions per RECIST 1.1, ECOG PS 0-1, adequate organ function, and compliance with contraception. Exclusions involve recent experimental/tumor therapy (within 4 weeks), prior Trop2-targeted treatment, severe topoisomerase I inhibitor toxicity, major surgery (within 4 weeks), or organ transplantation history.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05620017 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Multicenter, Open Phase I Clinical Study to Evaluate the Safety, Tolerance, Pharmacokinetics and Initial Efficacy of BAT8008 for Injection in Patients With Advanced Solid Tumor
|
||||
| Primary Endpoint |
The primary endpoints include dose-limiting toxicity (DLT), defined as grade ≥3 toxicity related to the investigational product within the first 21-day cycle, and maximum tolerated dose (MTD), determined as the highest dose with ≤1/6 subjects experiencing DLT during evaluation.
|
||||
| Other Endpoint |
Pharmacokinetic analysis includes AUC (0-inf) after cycle 6, measuring the area under the concentration-time curve from time 0 extrapolated to infinity, assessed 91 days post-first dose.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [13] | ||||
| Patients Enrolled |
Eligible patients are adults (≥18) with advanced/metastatic epithelial solid tumors (e.g., triple-negative breast cancer, NSCLC) refractory to standard therapy, measurable lesions (RECIST 1.1), ECOG PS 0-1, and adequate organ function. Key exclusions: recent experimental/anti-tumor therapy (4 weeks), prior Trop2-ADC/toisomerase I inhibitor toxicity, uncontrolled CNS metastases, active infections (HIV/HBV/HCV), severe cardiovascular disease, or immunosuppressive therapy within 14 days.
Click to Show/Hide
|
||||
| Administration Dosage |
BAT1308 injection: 25 mg/mL concentrate for solution for infusion.200 mg on Day 1 of each 14-day cycle BAT8008 injection: 20 mg/mL concentrate for solution for infusion.Climbing group A: 2.1mg/kg on Day 1 of each 14-day cycle,and Climbing group B: 2.4mg/kg on Day 1 of each 14-day cycle
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06341114 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Multicenter, Open-label Phase Ib-II Clinical Study Evaluating the Safety, Tolerability, Pharmacokinetic Characteristics, and Preliminary Efficacy of the Combination of BAT8008 With BAT1308 in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
Primary outcomes include dose-limiting toxicity (DLT) assessed within the first 21-day cycle, vital signs, physical exams, adverse events (AEs) per CTCAE v5.0, clinical lab abnormalities, and efficacy metrics (ORR, DOR, DCR, PFS, and OS) evaluated over a 1-year period via RECIST 1.1 criteria.
|
||||
| Other Endpoint |
Pharmacokinetic parameters (Tmax, CL, t½, Cmax, ADA, and Nab levels) are assessed at multiple timepoints across cycles (C1D1-C4D1, then every 4 cycles up to 26 cycles, each lasting 2 weeks).
|
||||
BL-M08D1 [Phase 1]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [14] | ||||
| Patients Enrolled |
Eligible patients (18-75 years) have recurrent/refractory lymphoid malignancies, ECOG≤2, adequate organ function, and no standard treatment options. Exclusions include recent anticancer therapy (<4 weeks), uncontrolled cardiac/autoimmune diseases, active infections (HIV/HBV/HCV), ILD, CNS involvement, or pregnancy. Archived tumor tissue within 2 years is required.
Click to Show/Hide
|
||||
| Administration Dosage |
Administration by intravenous infusion for a cycle of 3 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06718634 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetic Characteristics and Preliminary Efficacy of BL-M08D1 for Injection in Patients With Relapsed or Refractory Lymphoid Malignancies
|
||||
| Primary Endpoint |
The study evaluates safety in Phase Ia by assessing dose-limiting toxicities (DLTs) per NCI-CTCAE v5.0 within 21 days post-first dose to determine the maximum tolerated dose (MTD). Phase Ib defines the recommended Phase II dose (RP2D) based on integrated safety, efficacy, PK/PD data over ~24 months.
|
||||
| Other Endpoint |
Treatment-emergent adverse events (TEAEs) and PK parameters (Cmax, Tmax, T1/2, AUC0-t, CL, Ctrough) are monitored for ~24 months. Immunogenicity (ADA) and efficacy endpoints (ORR, DCR, DOR per RECIST 1.1) are assessed in Phase Ib to evaluate tumor response and disease control.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [15] | ||||
| Patients Enrolled |
Eligible patients (18-75 years, Phase Ia; ≥18 years, Phase Ib) have incurable metastatic solid tumors, ECOG 0-1, ≥3-month life expectancy, and measurable lesions. Exclusions include recent anticancer therapy (<4 weeks), uncontrolled cardiovascular disease, active infections (HIV/HBV/HCV), ILD, CNS metastases, organ transplants, or pregnancy. Contraception is required for 6 months post-treatment.
Click to Show/Hide
|
||||
| Administration Dosage |
Administration by intravenous infusion for a cycle of 3 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06718621 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Study to Evaluate the Safety, Tolerability, Pharmacokinetic Characteristics and Preliminary Efficacy of BL-M08D1 for Injection in Patients With Locally Advanced or Metastatic Solid Tumors
|
||||
| Primary Endpoint |
The Phase Ia study evaluates dose-limiting toxicity (DLT) per NCI-CTCAE v5.0 within 21 days post-dose to determine the maximum tolerated dose (MTD), while Phase Ib establishes the recommended Phase II dose (RP2D) over 24 months based on integrated safety, efficacy, pharmacokinetic (PK), and pharmacodynamic (PD) data for BL-M08D1.
|
||||
| Other Endpoint |
Safety assessments include treatment-emergent adverse events (TEAEs), PK parameters (Cmax, Tmax, T1/2, AUC0-t, CL, Ctrough), and immunogenicity (ADA) over 24 months. Efficacy is evaluated via objective response rate (ORR), disease control rate (DCR), and duration of response (DOR) per RECIST 1.1 criteria in Phase Ib.
|
||||
BAT8003 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [17] | ||||
| Patients Enrolled |
Eligible patients are aged 18-75 with advanced Trop2-positive epithelial cancer, measurable lesions (RECIST 1.1), ECOG 0-1, adequate organ function, and recovery from prior therapy (≤Grade 1 AEs, except alopecia). Exclusion criteria include active HBV/HCV/syphilis, immunodeficiency, uncontrolled infections, severe cardiopulmonary disease, CNS metastases, Grade ≥2 neuropathy, recent clinical trial participation, major surgery, strong CYP3A4 inhibitor use, allergies, pregnancy, substance abuse, or other investigator-deemed ineligibility.
Click to Show/Hide
|
||||
| Administration Dosage |
Phase 1 dose titration study from BAT8003 0.2mg/kg to 10mg/kg, then choose a proper dose for amplification study based on DLT result
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03884517 | Clinical Status | PHASE1 | ||
| Clinical Description |
An Open, Escalating Phase I Clinical Trial of BAT8003 (for Injection) on the Safety, Tolerability and Pharmacokinetics for Patients With Advanced Epithelial Cancer
|
||||
| Primary Endpoint |
The study assesses dose-limiting toxicity (DLT) and maximum tolerated dose (MTD) as safety/tolerability endpoints over 3 weeks. Pharmacokinetic parameters include AUC, Cmax, t1/2, and Tmax, measured within 24 weeks.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [19] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT03884517 | Clinical Status | Phase 1 | ||
| Clinical Description |
An open, escalating phase 1 clinical trial of BAT8003 (for injection) on the safety, tolerability and pharmacokinetics for patients with advanced epithelial cancer.
|
||||
DAC-002 [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [18] | ||||
| Patients Enrolled |
Eligible patients (18-75 years with ECOG 0-1) must have progressing advanced solid tumors after standard therapy, measurable disease per RECIST 1.1, and adequate organ function. Required fresh/archived tumor tissue within 1 year and recovery of prior treatment toxicities to ≤Grade 1 (excluding alopecia). Women of childbearing potential need negative pregnancy test.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04601285 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I, Open-label, First-in-human, Dose Escalation and Expansion Study to Evaluate the Safety, Tolerability and Pharmacokinetic Profile of Recombinant Humanized Anti-Trop2 mAb-Tub196 Conjugate in Patients With Advanced Solid Tumors.
|
||||
| Primary Endpoint |
The MTD determination will be based on DLTs observed during the first 21 days post-infusion, with safety monitoring continuing throughout the 1-year study period using CTCAE v5.0 criteria. Investigators will assess AE causality relative to JS108 treatment.
|
||||
| Other Endpoint |
Pharmacokinetic analysis will assess JS108 parameters including Cmax, Tmax, AUC0-inf, Vss, t½ and CL over one year. Secondary endpoints include immunogenicity (ADA), efficacy measures (ORR per RECIST 1.1, DOR, PFS, OS), and exploratory Trop2 biomarker correlations with response and toxicity.
|
||||
XYD-9668-198 [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [20] | ||||
| Patients Enrolled |
Patients with advanced solid tumors confirmed histologically or cytologically must have received standard treatment, have not responded to standard treatment, or have been intolerant to standard treatment, including, but not limited to, triple-negative breast cancer, cervical cancer, endometrial cancer, ovarian cancer, uroepithelial cancer, pancreatic cancer, esophageal cancer, and non-small cell lung cancer. Triple-negative breast cancer, cervical cancer, ovarian cancer and urothelial carcinoma were included in the dose expansion phase.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | CTR20231203 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
An open, multicenter Phase I/II clinical study to evaluate the safety, tolerability, pharmacokinetic profile and initial efficacy of XYD-9668-198 antibody coupling agent in patients with advanced solid tumors
|
||||
AU2023281032A1 ADC-5 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
25.61%
|
|||
| Method Description |
Proliferation Inhibition Action of Different Drugs on Tumor Cell (the maximum killing percentage relative to the control group) in HepG2
|
||||
| In Vivo Model | HepG2 CDX Mouse Model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
72.22%
|
|||
| Method Description |
Proliferation Inhibition Action of Different Drugs on Tumor Cell (the maximum killing percentage relative to the control group) in FaDu
|
||||
| In Vivo Model | FaDu CDX Mouse Model | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
98.21%
|
|||
| Method Description |
Proliferation Inhibition Action of Different Drugs on Tumor Cell (the maximum killing percentage relative to the control group) in BxPC-3
|
||||
| In Vivo Model | BxPC-3 CDX Mouse Model | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
98.21%
|
|||
| Method Description |
Proliferation Inhibition Action of Different Drugs on Tumor Cell (the maximum killing percentage relative to the control group) in BxPC-3
|
||||
| In Vivo Model | BxPC-3 CDX Mouse Model | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.1017 nM
|
|||
| Method Description |
Proliferation Inhibition Action of Different Drugs on Tumor Cells (IC50, nM) in BxPC-3
|
||||
| In Vitro Model | Pancreatic ductal adenocarcinoma | BxPC-3 cells | CVCL_0186 | ||
DS-1062 [Investigative]
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [22] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
72%
|
Positive TROP2 expression (TROP2+++/++) | ||
| Method Description |
This PDX was obtained in accordance with appropriate consent procedures. This ovarian PDX model was subcutaneously passaged in vivo as fragments from animal to animal in nude mice. When tumors reached approximately 250 mm 3 similar-sized tumors were randomly assigned to treatment groups, DS-1062 was administered as a single dose at 10 mg/kg on day 1. Duration of dosing was 21 days. TGI responses (Day 28 TGI%) was measurede.
Click to Show/Hide
|
||||
| In Vivo Model | CTG-3718 human patient-derived xenograft (PDX) model | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [22] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
88%
|
Positive TROP2 expression (TROP2+++/++) | ||
| Method Description |
Female Nude mice (Charles River) aged 5-8 weeks were used, following 7 days acclimatisation before entry into the study. The human patient-derived xenograft (PDX) model, CTG-3303, was established from fragments of freshly resected tumor of a triple negative breast cancer (TNBC) patient whom relapsed on treatment with PARP inhibitor talazoparib. This PDX was obtained in accordance with appropriate consent procedures. This TNBC PDX model was subcutaneously passaged in vivo as fragments from animal to animal in nude mice. When tumors reached approximately 250 mm 3 , similar-sized tumors were randomly assigned to treatment groups. DS-1062 was administered as a single dose at 10 mg/kg on day 1. Duration of dosing schedule was 21 days. TGI responses (Day 46 TGI%) was measurede.
Click to Show/Hide
|
||||
| In Vivo Model | CTG-3303 human patient-derived xenograft (PDX) model | ||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [22] | ||||
| Efficacy Data | Tumor Growth lnhibition value (TGl) |
82%
|
Positive TROP2 expression (TROP2+++/++) | ||
| Method Description |
Nude mice (Charles River) aged 5-8 weeks wereused,following 7 days acclimatisation before entry intothe study.5x106 NCI-N87 tumor cells (gastric cancercell line) (1:1 in Matrigel)were implantedsubcutaneously onto the flank of the female Nude mice.When tumors reached approximately 250 mm,similar-sizedtumors were randomly assigned to treatment groups, DS-1062 was administered as a single dose at 10 mg/kg on day 1. Duration of dosing schedule was 21 days.
Click to Show/Hide
|
||||
| In Vivo Model | NCI-N87 Xenograft model | ||||
AU2023281032A1 ADC-2 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | maximum killing percentage |
39 nM
|
Negative TROP2 expression ( TROP2-) | ||
| Method Description |
the maximum killing percentage relative to the control group in MDA-MB-468
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | maximum killing percentage |
59.29 nM
|
Positive TROP2 expression (TROP2 +++/++) | ||
| Method Description |
the maximum killing percentage relative to the control group in HCC1954
|
||||
| In Vitro Model | Breast ductal carcinoma | HCC1954 cells | CVCL_1259 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | maximum killing percentage |
65.17 nM
|
Positive TROP2 expression (TROP2 +++/++) | ||
| Method Description |
the maximum killing percentage relative to the control group in SK-BR-3
|
||||
| In Vitro Model | Breast adenocarcinoma | SK-BR-3 cells | CVCL_0033 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.1076 nM
|
Positive TROP2 expression (TROP2 +++/++) | ||
| Method Description |
Proliferation Inhibition Action of Different Drugs on Tumor Cells (IC50, nM) in SK-BR-3
|
||||
| In Vitro Model | Breast adenocarcinoma | SK-BR-3 cells | CVCL_0033 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.4355 nM
|
Positive TROP2 expression (TROP2 +++/++) | ||
| Method Description |
Proliferation Inhibition Action of Different Drugs on Tumor Cells (IC50, nM) in HCC1954
|
||||
| In Vitro Model | Breast ductal carcinoma | HCC1954 cells | CVCL_1259 | ||
AU2023281032A1 ADC-3 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [21] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) |
0.1928 nM
|
|||
| Method Description |
Proliferation Inhibition Action of Different Drugs on Tumor Cells (IC50, nM)in BxPC-3.
|
||||
| In Vitro Model | Pancreatic ductal adenocarcinoma | BxPC-3 cells | CVCL_0186 | ||
References
