Antibody Information

General Information of This Antibody

Antibody ID	ANTI0RJEXC
Antibody Name	BGA5384
Organization	BEIGENE, LTD. \| BEIGENE SWITZERLAND GMBH
Synonyms	BGA5384 Click to Show/Hide
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized lgG
Antigen Name	Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5)	Antigen Info
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	QVQLVQSGAEVKKPGASVKVSCKASGYIFTSYYLHWVRQAPGQGLEWIGYINPQTGKTSY AQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAREYGNYNYPLDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
Heavy Chain Varible Domain	QVQLVQSGAEVKKPGASVKVSCKASGYIFTSYYLHWVRQAPGQGLEWIGYINPQTGKTSY AQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAREYGNYNYPLDYWGQGTLVTVSS Click to Show/Hide
Heavy Chain CDR 1	GYIFTSYY Click to Show/Hide
Heavy Chain CDR 2	INPQTGKT Click to Show/Hide
Heavy Chain CDR 3	AREYGNYNYPLDY Click to Show/Hide
Light Chain Sequence	DIQMTQSPSSLSASVGDRVTITCRASENQYGYLAWYQQKPGKVPKLLIYNYKNLVEGVPS RFSGSGSGTDFTLTISSLQPEDVATYYCQHHLGTPYTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
Light Chain Varible Domain	DIQMTQSPSSLSASVGDRVTITCRASENQYGYLAWYQQKPGKVPKLLIYNYKNLVEGVPS RFSGSGSGTDFTLTISSLQPEDVATYYCQHHLGTPYTFGQGTKVEIK Click to Show/Hide
Light Chain CDR 1	ENQYGY Click to Show/Hide
Light Chain CDR 2	NY Click to Show/Hide
Light Chain CDR 3	QHHLGTPYT Click to Show/Hide

Each Antibody-drug Conjugate Related to This Antibody

Full Information of The Activity Data of The ADC(s) Related to This Antibody

BGA9962 [Investigative]

ADC Info

Discovered Using Patient-derived Xenograft Model

Click To Hide/Show 2 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC				[1]
Efficacy Data	Tumor Growth lnhibition value (TGl)	106%	Positive CEA expression (CEA+++/++)
Method Description	Human patient-derived gastric tumors were induced on the right flank by a subcutaneous injection. When tumor volume reached approximately 200 mm3 in size, mice were randomized into 5 groups with 8, 9, and 9 animals in vehicle, BGA7650, and BGA9962 groups on Day 0, respectively. After ensuring all cohorts hadapproximately equal average tumor volumes to start, animals were intravenously administered vehicle, BGA9962 (2 mg/kg) on treatment Day 1. Animal body weight and tumor volume were measured twice weekly. Click to Show/Hide
In Vivo Model	Human patient-derived gastric xenograft model
Experiment 2 Reporting the Activity Date of This ADC				[1]
Efficacy Data	Tumor Growth lnhibition value (TGl)	107%	Positive CEA expression (CEA+++/++)
Method Description	Human patient-derived gastric tumors were induced on the right flank by a subcutaneous injection. When tumor volume reached approximately 200 mm3 in size, mice were randomized into 5 groups with 8, 9, and 9 animals in vehicle, BGA7650, and BGA9962 groups on Day 0, respectively. After ensuring all cohorts hadapproximately equal average tumor volumes to start, animals were intravenously administered vehicle, BGA9962 (6 mg/kg) on treatment Day 1. Animal body weight and tumor volume were measured twice weekly. Click to Show/Hide
In Vivo Model	Human patient-derived gastric xenograft model

Revealed Based on the Cell Line Data

Click To Hide/Show 4 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.17 nM	Positive CEA expression (CEA+++/++)
Method Description	NCI-H2122 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Lung adenocarcinoma	NCI-H2122 cells		CVCL_1531
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.39 nM	Positive CEA expression (CEA+++/++)
Method Description	MKN45 cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Gastric adenocarcinoma	MKN45 cells		CVCL_0434
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.83 nM	Positive CEA expression (CEA+++/++)
Method Description	Ls147T cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Colon adenocarcinoma	Ls147T cells		CVCL_1384
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	27 nM	Negative CEA expression (CEA-)
Method Description	MDA-MB-231 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Breast adenocarcinoma	MDA-MB-231 cells		CVCL_0062

BGA8357 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 4 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.14 nM	Positive CEA expression (CEA+++/++)
Method Description	NCI-H2122 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Lung adenocarcinoma	NCI-H2122 cells		CVCL_1531
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.38 nM	Positive CEA expression (CEA+++/++)
Method Description	MKN45 cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Gastric adenocarcinoma	MKN45 cells		CVCL_0434
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.67 nM	Positive CEA expression (CEA+++/++)
Method Description	Ls147T cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Colon adenocarcinoma	Ls147T cells		CVCL_1384
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	26 nM	Negative CEA expression (CEA-)
Method Description	MDA-MB-231 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Breast adenocarcinoma	MDA-MB-231 cells		CVCL_0062

BGA7413 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 4 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.16 nM	Positive CEA expression (CEA+++/++)
Method Description	NCI-H2122 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Lung adenocarcinoma	NCI-H2122 cells		CVCL_1531
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.46 nM	Positive CEA expression (CEA+++/++)
Method Description	MKN45 cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Gastric adenocarcinoma	MKN45 cells		CVCL_0434
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.88 nM	Positive CEA expression (CEA+++/++)
Method Description	Ls147T cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Colon adenocarcinoma	Ls147T cells		CVCL_1384
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	28 nM	Negative CEA expression (CEA-)
Method Description	MDA-MB-231 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Breast adenocarcinoma	MDA-MB-231 cells		CVCL_0062

BGA0179 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 4 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.16 nM	Positive CEA expression (CEA+++/++)
Method Description	NCI-H2122 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Lung adenocarcinoma	NCI-H2122 cells		CVCL_1531
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.3 nM	Positive CEA expression (CEA+++/++)
Method Description	MKN45 cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Gastric adenocarcinoma	MKN45 cells		CVCL_0434
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.62 nM	Positive CEA expression (CEA+++/++)
Method Description	Ls147T cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Colon adenocarcinoma	Ls147T cells		CVCL_1384
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	24 nM	Negative CEA expression (CEA-)
Method Description	MDA-MB-231 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Breast adenocarcinoma	MDA-MB-231 cells		CVCL_0062

BGA0084 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 4 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.19 nM	Positive CEA expression (CEA+++/++)
Method Description	NCI-H2122 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Lung adenocarcinoma	NCI-H2122 cells		CVCL_1531
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.38 nM	Positive CEA expression (CEA+++/++)
Method Description	MKN45 cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Gastric adenocarcinoma	MKN45 cells		CVCL_0434
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.85 nM	Positive CEA expression (CEA+++/++)
Method Description	Ls147T cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Colon adenocarcinoma	Ls147T cells		CVCL_1384
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	25 nM	Negative CEA expression (CEA-)
Method Description	MDA-MB-231 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Breast adenocarcinoma	MDA-MB-231 cells		CVCL_0062

BGA2490 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 4 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.19 nM	Positive CEA expression (CEA+++/++)
Method Description	NCI-H2122 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Lung adenocarcinoma	NCI-H2122 cells		CVCL_1531
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.44 nM	Positive CEA expression (CEA+++/++)
Method Description	MKN45 cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Gastric adenocarcinoma	MKN45 cells		CVCL_0434
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.76 nM	Positive CEA expression (CEA+++/++)
Method Description	Ls147T cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Colon adenocarcinoma	Ls147T cells		CVCL_1384
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	21 nM	Negative CEA expression (CEA-)
Method Description	MDA-MB-231 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Breast adenocarcinoma	MDA-MB-231 cells		CVCL_0062

BGA2588 [Investigative]

ADC Info

Revealed Based on the Cell Line Data

Click To Hide/Show 4 Activity Data Related to This Level

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.22 nM	Positive CEA expression (CEA+++/++)
Method Description	NCI-H2122 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Lung adenocarcinoma	NCI-H2122 cells		CVCL_1531
Experiment 2 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	0.46 nM	Positive CEA expression (CEA+++/++)
Method Description	MKN45 cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Gastric adenocarcinoma	MKN45 cells		CVCL_0434
Experiment 3 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	1.12 nM	Positive CEA expression (CEA+++/++)
Method Description	Ls147T cells were plated at a density of 5000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Colon adenocarcinoma	Ls147T cells		CVCL_1384
Experiment 4 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Half Maximal Effective Concentration (EC50)	> 100 nM	Negative CEA expression (CEA-)
Method Description	MDA-MB-231 cells were plated at a density of 2000 cells per well and the next day were treated with payload compounds (5x dilution) for 6 days.
In Vitro Model	Breast adenocarcinoma	MDA-MB-231 cells		CVCL_0062

References

Ref 1	Anti-CEA antibody drug conjugates and methods of use

Antibody Information

Citation

Visitor Map

Correspondence

Prof. Feng ZHU (zhufeng@zju.edu.cn)

Prof. Xiaowu DONG (dongxw@zju.edu.cn)

Prof. Luo FANG (fangluo@zjcc.org.cn)