Antibody Information
General Information of This Antibody (ID: ANTI0MWWFT)
| Antibody Name | Ruzaltatug |
|||||
|---|---|---|---|---|---|---|
| Synonyms |
Ruzaltatug
Click to Show/Hide
|
|||||
| Antigen Name | Receptor tyrosine-protein kinase erbB-3 (ERBB3) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGISWNSGSIGY
ADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAKEGLPGLDYWGQGTLVTVSSAST KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASIGDRATITCRASQHVGTYLNWYQQKPGKTPKLLISGAANLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYNTPPFSFGQGTKVEIKRTVAAPSVFIFP PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Ruzaltatug rezetecan [Phase 3]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
39.10%
|
|||
| Patients Enrolled |
Eligible patients have histologically confirmed advanced/metastatic solid tumors refractory to standard therapy, ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, life expectancy ≥12 weeks, and adequate organ function. Exclusions include active CNS metastases, recent antitumor therapy (≤4 weeks), prior topoisomerase-I ADC treatment, severe CV/cerebrovascular disease, recent infection (≤4 weeks), or unresolved prior treatment toxicities (Grade >1).
Click to Show/Hide
|
||||
| Administration Dosage |
SHR-A2009 was given at doses of 1.5-10.5 mg/kg (Q3W, iv) in an i3+3 dose escalation scheme, followed by cohort expansion at selected doses
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05114759 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I, Open-Label, Multicenter Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of SHR-A2009 for Injection in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
The Phase 1 study evaluates MTD/MAD (Days 1-21) and DLTs during the first cycle. RP2D will be determined based on MTD/MAD, PK, and efficacy data (Days 1 to 90 post-last dose). Safety is assessed through AEs/SAEs (CTCAE v5.0) during the same period.
|
||||
| Other Endpoint |
PK parameters include Tmax, Cmax, AUC0-t, and AUC0-∞ (≤6 months), while immunogenicity (ADA) is tracked for ≤9 months. Efficacy measures (ORR, DoR, DCR, PFS; ≤36 months) are assessed per RECIST 1.1 in later phases.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Eligible participants are women (18-75) with metastatic/locally advanced breast cancer (ER+/HER2± or TNBC), ECOG 0-1, measurable lesions per RECIST v1.1, and adequate organ function. Exclusions include active CNS metastases, uncontrolled infections, severe cardiovascular/autoimmune diseases, recent immunosuppression, untreated hepatitis, concurrent malignancies, HIV/organ transplant history, or drug component allergies.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06222879 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Multi-center, Open-label Phase Ib/II Clinical Study on the Safety, Tolerability, Pharmacokinetics and Efficacy of HRS-8080 or SHR-A2009 Combined With Anti-tumor Therapy in Patients With Unresectable or Metastatic Breast Cancer
|
||||
| Primary Endpoint |
Phase 1 assesses safety through DLT evaluation (21-day cycle) to establish MTD and RP2D, while monitoring AEs/SAEs (CTCAE v5.0) for 12 months. Phase 2 measures efficacy via ORR over 12 months.
|
||||
| Other Endpoint |
Immunogenicity assessments track ADA/Nab levels for SHR-A1811, SHR-A2009, and adebrelimab in both phases (12 months). Efficacy measures (ORR, BOR, DoR, DCR, CBR, PFS) and safety outcomes are evaluated identically across phases for 12 months.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible participants are adults (≥18) with locally advanced/metastatic breast cancer (any HR status) who received prior ADCs and CDK4/6 inhibitors (HR+), have measurable disease (RECIST 1.1), and adequate organ function. Exclusions include active CNS metastases, uncontrolled HBV/HCV/HIV, recent immunosuppression/therapy (≤3 weeks), severe cardiac disease, autoimmune disorders, or pregnancy. Lab criteria require ANC≥1.5×10^9/L, PLT≥75×10^9/L, and LVEF≥50%.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06649331 | Clinical Status | PHASE2 | ||
| Clinical Description |
Platform Study of ADC Rechallenge in ADC-treated Metastatic Breast Cancer:A Prospective, Open-label, Multicenter, Phase II Trial
|
||||
| Primary Endpoint |
The primary efficacy endpoint is ORR (≤36 months), defined as complete/partial response per RECIST 1.1 in participants with measurable disease at baseline. Radiographic assessments will determine best overall response.
|
||||
| Other Endpoint |
Secondary endpoints include PFS (time to progression/death, ≤36 months), CBR (CR+PR+SD≥24 weeks), and DoR (time from response to progression/death). OS (≤5 years) tracks survival from randomization. Safety evaluates treatment-related AEs (CTCAE v5.0, ≤36 months).
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Eligible participants are women ≥18 with HR+/HER2- locally advanced/metastatic breast cancer (ER/PR>10%, HER2 0-1+/FISH-negative) who failed CDK4/6 inhibitors, have measurable lesions (RECIST 1.1), adequate organ function (ANC≥1.5×10<sup>9</sup>/L, Cr≤1×ULN), and ECOG≤2. Exclusions include active CNS metastases, recent cardiac events (≤6 months), major surgery/therapy (≤3 weeks), pregnancy, or other malignancies (≤5 years). Contraception is required for 3 months post-treatment.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05594095 | Clinical Status | PHASE2 | ||
| Clinical Description |
Precision Platform Study of HR+/ HER2-advanced Breast Cancer Based on SNF Typing (A Prospective, Open-label, Multi-center, Phase II Platform Study)
|
||||
| Primary Endpoint |
The primary efficacy endpoint is ORR (≤3 years) defined as the proportion of participants achieving complete or partial response based on RECIST 1.1 criteria during the study period until disease progression or death occurs.
|
||||
| Other Endpoint |
Secondary endpoints include CBR (CR+PR+SD≥24 weeks, ≤3 years), PFS (time to progression, RECIST 1.1), OS (time to death, ≤3 years), and CTCAE v5.0 graded AEs (≤1 year). Exploratory biomarker analysis will examine tumor/blood/feces samples for correlations with treatment response.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Eligible patients are adults (18-75) with locally advanced/unresectable or metastatic ESCC who progressed after first-line chemo/immunotherapy (PFS≥3 months if prior IO), have measurable lesions (RECIST 1.1), ECOG 0-1, adequate organ function (ANC≥1.5×10<sup>9</sup>/L, LVEF≥50%), and tissue for biomarker analysis. Key exclusions: active autoimmune disease, uncontrolled infections (HBV/HCV), recent bleeding/thrombosis, CNS metastases, immunosuppressant use (>10mg/day prednisone), pregnancy, or other malignancies (≤5 years). Contraception required for 6 months post-treatment.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03736863 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase II Exploratory Clinical Trial of Multiple Drug Combinations in the Treatment of Advanced Esophageal Squamous Cell Carcinoma
|
||||
| Primary Endpoint |
The primary endpoint is ORR (≤1 year), measured as the proportion of patients achieving confirmed complete or partial response (RECIST 1.1) on two consecutive assessments ≥4 weeks apart.
|
||||
| Other Endpoint |
Secondary endpoints include DCR (CR+PR+SD, ≤1 year), PFS (time to progression/death, ≤2 years), DoR (response duration), TTR (time to first response, ≤1 year), OS (≤2 years), PFS rates (3-/6-month), OS rates (6-/9-/12-month), and safety (AE monitoring, ≤2 years).
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [6] | ||||
| Patients Enrolled |
Eligible patients (18-75 years) must have metastatic NSCLC (AJCC 8th edition), progressed post standard and ADC therapy, ≥1 measurable lesion per RECIST 1.1, ECOG 0-1, life expectancy ≥12 weeks, adequate organ function, and contraceptive agreement. Exclusions: untreated brain/meningeal metastases, symptomatic malignant effusions, prior systemic therapy, major surgery/radiotherapy (≤4 weeks), second malignancies, active hepatitis/TB, uncontrolled hypertension, unresolved toxicities, severe prior hypersensitivity, or other conditions that may compromise study integrity.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06465238 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase II Study of the Efficacy and Safety of SHR-A1921 or SHR-A2009 in Patients With Previously Treated Advanced NSCLC
|
||||
| Primary Endpoint |
The primary endpoint is ORR (≤12 months), evaluated by investigators per RECIST v1.1 criteria.
|
||||
| Other Endpoint |
Secondary endpoints include PFS (≤12 months), OS (≤24 months), DoR (≤12 months), DCR (≤12 months), TTR (≤12 months), and AEs (severity per CTCAE v5.0, assessed from Day 1 to 90 days post-treatment).
|
||||
| Experiment 7 Reporting the Activity Date of This ADC | [7] | ||||
| Patients Enrolled |
Eligible patients are aged 18-75 with unresectable/metastatic non-squamous NSCLC, prior EGFR-TKI failure, ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, life expectancy ≥12 weeks, and adequate organ function. Exclusions: active CNS metastases, recent antitumor therapy or major surgery (≤4 weeks), other malignancies (≤5 years), interstitial lung disease, severe cardiovascular disorders, active infections (≤4 weeks), recent thrombosis (≤3 months), HIV/hepatitis B/C, or hypersensitivity to study drugs.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06671379 | Clinical Status | PHASE3 | ||
| Clinical Description |
A Randomized, Open-label, Multicenter, Phase III Study of SHR-A2009 Versus Platinum-based Chemotherapy in EGFR-mutated, Advanced or Metastatic Non-small Cell Lung Cancer After Failure of Epidermal Growth Factor Receptor (EGFR) Tyrosine Kinase Inhibitor (TKI) Therapy
|
||||
| Primary Endpoint |
The primary endpoint is PFS (≤32 months), evaluated by Blinded Independent Central Review (BICR) per RECIST v1.1.
|
||||
| Other Endpoint |
Secondary endpoints include OS (≤32 months), investigator-assessed PFS (≤32 months), BICR/investigator-assessed DoR (≤32 months), DCR (≤32 months), and AE incidence (Day 1 to 40 days post-treatment).
|
||||
| Experiment 8 Reporting the Activity Date of This ADC | [8] | ||||
| Patients Enrolled |
Eligible patients (18-75 years) must have histologically confirmed advanced/metastatic solid tumors, ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, life expectancy ≥12 weeks, and adequate organ function. Exclusions: active CNS metastases, untreated spinal compression, uncontrolled pain/effusions, recent antitumor therapy/radiotherapy/surgery (≤4 weeks), secondary malignancies (≤3 years), interstitial lung disease, severe cardiocerebrovascular conditions, recent bleeding (≤3 months), HIV/hepatitis B/C, drug allergies, substance dependence, or psychiatric/pregnancy-related contraindications.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06474455 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase IB/II, Open-Label, Multicentre Clinical Study to Evaluate the Safety, Tolerability and Efficacy of SHR-9839 for Injection in Combination With Other Therapies in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
In Phase IB, primary endpoints include DLT incidence (first 21 days post-dose) and AE/SAE/lab abnormality frequency/severity (until safety follow-up completion, ≤24 months), assessed via CTCAE v5.0. Phase II evaluates ORR (until progression, ≤24 months) per RECIST 1.1.
|
||||
| Other Endpoint |
Phase II secondary endpoints monitor AE/SAE/lab abnormalities (ICF signing to safety follow-up end, ≤24 months), with safety assessed per CTCAE v5.0.
|
||||
| Experiment 9 Reporting the Activity Date of This ADC | [9] | ||||
| Patients Enrolled |
Eligible patients must have confirmed metastatic/refractory solid tumors with ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, life expectancy ≥12 weeks, and adequate organ function. Exclusions include active CNS metastases, recent antitumor therapy (≤4 weeks), prior topoisomerase-I ADC use, severe cardiovascular conditions, recent severe infections (≤4 weeks), or unresolved treatment-related toxicities (Grade>1).
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05394818 | Clinical Status | PHASE1 | ||
| Clinical Description |
An Open-label, Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Efficacy of SHR-A2009 for Injection in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
Phase I evaluates MTD/MAD and DLT incidence during the initial treatment cycle (Day 1-90 post-last dose). RP2D will be determined based on safety (MTD/MAD), PK, and efficacy data, with AE/SAE monitoring per CTCAE v5.0 for tolerability assessment.
|
||||
| Other Endpoint |
PK analysis includes Tmax, Cmax, AUC0-t, and AUC0-∞ (≤6 months), alongside immunogenicity (ADA, ≤9 months). Efficacy outcomes (ORR, DoR, DCR, PFS; ≤36 months) are evaluated per RECIST 1.1 criteria.
|
||||
| Experiment 10 Reporting the Activity Date of This ADC | [10] | ||||
| Patients Enrolled |
Eligible patients (18-75 years) have confirmed advanced/metastatic NSCLC, ≥1 measurable lesion (RECIST 1.1), ECOG 0-1, and adequate organ function. Exclusions: active CNS metastases, unresolved spinal cord compression, recent antitumor therapy (≤4 weeks), major surgery/trauma (≤4 weeks), untreated autoimmune diseases, severe infections (≤4 weeks), HBV/HIV positivity, or prior severe allergic reactions to monoclonal antibodies or SHR-A2009 components.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06092268 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase IB/II, Open-Label, Multicentre Clinical Study to Evaluate the Safety, Tolerability and Efficacy of SHR-A2009 for Injection in Combination With Other Therapies in Patients With Advanced Solid Tumors
|
||||
| Primary Endpoint |
The study assesses DLT incidence (Phase IB, first 21 days post-dose) and ORR (Phase II, 2-year follow-up). Safety parameters include AEs and SAEs monitored for 90 days post-treatment in Phase II efficacy expansion.
|
||||
| Other Endpoint |
PK evaluation focuses on SHR-A2009 toxin-binding antibodies, total antibodies, and free toxin over ~2 years, alongside plasma concentration and immunogenicity of SHR-A2009/Adebrelimab. Efficacy metrics (DoR, PFS, ORR) track responses up to 2 years, while OS extends to 3 years in Phase IB.
|
||||
| Experiment 11 Reporting the Activity Date of This ADC | [11] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05394818 | Clinical Status | Phase 1 | ||
| Clinical Description |
An open-label, phase 1 clinical study to evaluate the safety, tolerability, pharmacokinetics and efficacy of SHR-A2009 for injection in patients with advanced solid tumors.
|
||||
| Experiment 12 Reporting the Activity Date of This ADC | [12] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT05114759 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1, open-label, multicenter clinical study to evaluate the safety, tolerability, pharmacokinetics and efficacy of SHR-A2009 for injection in patients with advanced solid tumors.
|
||||
References
