Antibody Information

General Information of This Antibody
Antibody ID
ANTI0KOKFK
Antibody Name
torvutatug
Antigen Name
FRα
  Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Varible Domain
LVQLQQSGPGLVKPSQTLSLTCAISGDSVSSDSATWNWIRQSPSRGLEWLGRTYYRSKWY
NDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCARGVGSFDYWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Varible Domain
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASGLESGVPS
RFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYSQLTFGGGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Torvutatug samrotecan [Phase 3]
 ADC Info 
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible participants ≥18 years have advanced solid tumors, measurable disease (RECIST v1.1), ECOG 0-1, and adequate organ function. Exclusions: uncontrolled infections (HBV/HCV/HIV), active ILD, significant cardiac disease (QTc >470 ms, heart failure), recent cancer (except cured malignancies), or pregnancy. Contraception is mandated. Prior therapies must meet washout criteria.

   Click to Show/Hide
Administration Dosage
Pts aged ≥18 years with PRROC were recruited irrespective of tumour FRalpha expression and without a limit on the number of prior lines of therapy. AZD5335 was administered intravenously Q3W until disease progression, unacceptable toxicity, or other reason for discontinuation.
Related Clinical Trial
NCT Number NCT05797168  Clinical Status PHASE1|||PHASE2
Clinical Description
A Modular Phase I/IIa, Open-label Study to Assess the Safety, Tolerability, Pharmacokinetics and Preliminary Efficacy of Ascending Doses of AZD5335 Monotherapy and in Combination With Anti-cancer Agents in Participants With Solid Tumors
Primary Endpoint
The study assesses the safety and tolerability of AZD5335/AZD5305 by monitoring adverse events (AEs), serious adverse events (SAEs), and dose-limiting toxicities (DLTs) per NCI CTCAE v5.0, including lab abnormalities, vital signs, and ECGs.
Other Endpoint
Efficacy is evaluated via RECIST v1.1, measuring ORR (CR/PR), DCR (CR/PR/SD ≥15 weeks), DoR, PFS, and OS. PK parameters (AUC, Cmax, Tmax, clearance, t1/2) are analyzed for AZD5335 alone or combined with AZD5305/bevacizumab/carboplatin. Immunogenicity (ADA development) and tumor target expression changes are also assessed.
Experiment 2 Reporting the Activity Date of This ADC [2]
Related Clinical Trial
NCT Number NCT05797168  Clinical Status Phase 1/2
Clinical Description
FONTANA: A modular phase 1/2a, open-label, multi-center study to assess the safety, tolerability, pharmacokinetics, and preliminary efficacy of ascending doses of AZD5335 monotherapy and in combination with anti-cancer agents in participants with solid tumors.
Primary Endpoint
Number of participants with adverse events/serious adverse events, the number of participants with dose limiting toxicity (DLT).
Other Endpoint
Objective Response Rate (ORR), Duration of Response (DoR), Disease Control Rate (DCR), Progression free Survival (PFS), Overall Survival (OS).
References
Ref 1 Phase I/IIa Study of AZD5335 as Monotherapy and Combination Therapy in Participants With Solid Tumors
Ref 2 FONTANA: A Modular Phase I/IIa, Open-label, Multi-center Study to Assess the Safety, Tolerability, Pharmacokinetics, and Preliminary Efficacy of Ascending Doses of AZD5335 Monotherapy and in Combination With Anti-cancer Agents in Participants With Solid Tumors, NCT05797168