Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0KHGYL |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | hBU12ec |
|||||
| Antigen Name | CD19 |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
QVQLQESGPGLVKPSQTLSLTCTVSGGSISTSGMGVGWIRQHPGKGLEWIGHIWWDDDKR
YNPALKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARMELWSYYFDYWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
EIVLTQSPATLSLSPGERATLSCSASSSVSYMHWYQQKPGQAPRLLIYDTSKLASGIPAR
FSGSGSGTDFTLTISSLEPEDVAVYYCFQGSVYPFTFGQGTKLEIKR Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
SGN-CD19B [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligibility requires measurable disease after ≥2 prior systemic therapies with ECOG 0-1 and adequate organ function, excluding patients with prior CD19-targeted therapy (unless CD19+ confirmed), active infections, allogeneic transplants, or recent anticancer treatments within 4 weeks (2 weeks if progressive disease).
|
||||
| Administration Dosage |
Given intravenously Day 1 of 28-day or 42-day cycles
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT02702141 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, Open-label, Dose-escalation Study of SGN-CD19B in Patients With Relapsed or Refractory Aggressive B-cell Non-Hodgkin Lymphoma
|
||||
| Primary Endpoint |
The primary endpoints evaluate safety profiles including adverse event incidence and laboratory abnormalities monitored through 1 month post-treatment in relapsed/refractory patients.
|
||||
| Other Endpoint |
Secondary objectives assess pharmacokinetics (SGN-CD19B blood concentrations for 3 weeks), immunogenicity (antitherapeutic antibodies), and efficacy measures (objective response rate, progression-free survival up to 3 years) in this heavily pretreated population.
|
||||