General Information of This Antibody (ID: ANTI0KHGYL)
Antibody Name
hBU12ec
Antigen Name
CD19
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLQESGPGLVKPSQTLSLTCTVSGGSISTSGMGVGWIRQHPGKGLEWIGHIWWDDDKR
YNPALKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARMELWSYYFDYWGQGTLVTVSS
    Click to Show/Hide
Heavy Chain Varible Domain
QVQLQESGPGLVKPSQTLSLTCTVSGGSISTSGMGVGWIRQHPGKGLEWIGHIWWDDDKR
YNPALKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARMELWSYYFDYWGQGTLVTVSS
    Click to Show/Hide
Light Chain Sequence
EIVLTQSPATLSLSPGERATLSCSASSSVSYMHWYQQKPGQAPRLLIYDTSKLASGIPAR
FSGSGSGTDFTLTISSLEPEDVAVYYCFQGSVYPFTFGQGTKLEIKR
    Click to Show/Hide
Light Chain Varible Domain
EIVLTQSPATLSLSPGERATLSCSASSSVSYMHWYQQKPGQAPRLLIYDTSKLASGIPAR
FSGSGSGTDFTLTISSLEPEDVAVYYCFQGSVYPFTFGQGTKLEIKR
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
SGN-CD19B [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligibility requires measurable disease after ≥2 prior systemic therapies with ECOG 0-1 and adequate organ function, excluding patients with prior CD19-targeted therapy (unless CD19+ confirmed), active infections, allogeneic transplants, or recent anticancer treatments within 4 weeks (2 weeks if progressive disease).
Administration Dosage
Given intravenously Day 1 of 28-day or 42-day cycles
Related Clinical Trial
NCT Number NCT02702141  Clinical Status PHASE1
Clinical Description
A Phase 1, Open-label, Dose-escalation Study of SGN-CD19B in Patients With Relapsed or Refractory Aggressive B-cell Non-Hodgkin Lymphoma
Primary Endpoint
The primary endpoints evaluate safety profiles including adverse event incidence and laboratory abnormalities monitored through 1 month post-treatment in relapsed/refractory patients.
Other Endpoint
Secondary objectives assess pharmacokinetics (SGN-CD19B blood concentrations for 3 weeks), immunogenicity (antitherapeutic antibodies), and efficacy measures (objective response rate, progression-free survival up to 3 years) in this heavily pretreated population.
References
Ref 1 A Safety Study of SGN-CD19B in Patients With B-cell Non-Hodgkin Lymphoma