Antibody Information
General Information of This Antibody (ID: ANTI0HPJGJ)
| Antibody Name | Felmetatug |
|||||
|---|---|---|---|---|---|---|
| Organization | Seagen Inc. |
|||||
| Synonyms |
Felmetatug
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | V-set domain-containing T-cell activation inhibitor 1 (VTCN1) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QLQLQESGPGLVKPSETLSLTCTVSGGSIKSGSYYWGWIRQPPGKGLEWIGNIYYSGSTY
YNPSLRSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAREGSYPNQFDPWGQGTLVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYHSFPFTFGGGTKVEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Felmetatug vedotin [Phase 1 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligible participants have locally advanced/metastatic solid tumors (ovarian, breast, lung, etc.), ECOG 0-1, measurable disease (RECIST v1.1), and tumor tissue for analysis. Key exclusions: recent malignancies (≤3 years), active brain metastases (unless stable ≥4 weeks post-treatment), prior MMAE/B7-H4 therapy, Grade ≥2 neuropathy, or active corneal disease.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05194072 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1 Study of SGN-B7H4V in Advanced Solid Tumors
|
||||
| Primary Endpoint |
Safety will be assessed through AE monitoring up to 5 years post-treatment, including laboratory abnormalities and DLTs (within 28 days of dosing), with overall safety evaluated across dose levels.
|
||||
| Other Endpoint |
Efficacy endpoints include confirmed ORR, CRR, DOR, PFS, and iDFS tracked up to 5 years per RECIST v1.1. PK parameters (AUC, Cmax, Tmax, t1/2, Ctrough) and ADA incidence will be analyzed descriptively over 3 years post-treatment.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Locally advanced unresectable or metastatic solid tumors.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05194072 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 study of SGN-B7H4V in advanced solid tumors.
|
||||
References
