General Information of This Antibody (ID: ANTI0HPJGJ)
Antibody Name
Felmetatug
Organization
Seagen Inc.
Synonyms
Felmetatug
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
V-set domain-containing T-cell activation inhibitor 1 (VTCN1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QLQLQESGPGLVKPSETLSLTCTVSGGSIKSGSYYWGWIRQPPGKGLEWIGNIYYSGSTY
YNPSLRSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAREGSYPNQFDPWGQGTLVTVSS
    Click to Show/Hide
Light Chain Sequence
EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASTRATGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYHSFPFTFGGGTKVEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Felmetatug vedotin [Phase 1 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible participants have locally advanced/metastatic solid tumors (ovarian, breast, lung, etc.), ECOG 0-1, measurable disease (RECIST v1.1), and tumor tissue for analysis. Key exclusions: recent malignancies (≤3 years), active brain metastases (unless stable ≥4 weeks post-treatment), prior MMAE/B7-H4 therapy, Grade ≥2 neuropathy, or active corneal disease.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT05194072  Clinical Status PHASE1
Clinical Description
A Phase 1 Study of SGN-B7H4V in Advanced Solid Tumors
Primary Endpoint
Safety will be assessed through AE monitoring up to 5 years post-treatment, including laboratory abnormalities and DLTs (within 28 days of dosing), with overall safety evaluated across dose levels.
Other Endpoint
Efficacy endpoints include confirmed ORR, CRR, DOR, PFS, and iDFS tracked up to 5 years per RECIST v1.1. PK parameters (AUC, Cmax, Tmax, t1/2, Ctrough) and ADA incidence will be analyzed descriptively over 3 years post-treatment.
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Locally advanced unresectable or metastatic solid tumors.
Related Clinical Trial
NCT Number NCT05194072  Clinical Status Phase 1
Clinical Description
A phase 1 study of SGN-B7H4V in advanced solid tumors.
References
Ref 1 A Study of SGN-B7H4V in Advanced Solid Tumors
Ref 2 First-in-human phase I study of ALT-P7, a HER2-targeting antibody-drug conjugate in patients with HER2-positive advanced breast cancer. J Clin Oncol. 2020 38:15_suppl, 3551-3551.