General Information of This Antibody (ID: ANTI0HBVAB)
Antibody Name
Anti-hCLDN6 antibody Ab2
Organization
ASTELLAS PHARMA INC.
Synonyms
Ab2
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized lgG1
Antigen Name
Claudin-6 (CLDN6)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVOQLVESGGGVVQOPGGSLRLSCKASGYSFTGYTMNWVRQAPGKGLEWVGLINPYNGGT
IYNQKFKGRFTLSVDKSKSTAYLOMNSLRAEDTAVYYCARDYGYVLDYWGRGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLOSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTOQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQLTQSPSSLSASVGDRVTITCSASSSVSYLHWFQQKPGKAPKLLVYSTSNLPSGVPSR
FSGSGSGTDYTLTISSLOPEDFATYYCQQRSIYPPWTFGQGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHOQGLSSPVTKSFNRGEC
    Click to Show/Hide
The Activity Data of This Antibody
Antibody Activity Information 1 [1]
Half Maximal Effective Concentration (EC50)
800≈1000
ng/mL
Human gastric cancer cell lineNUGC-3 (JCRB cell bank) expressing CLDN7 CVCL_1612 
Antigen Expression Positive hCLDN6 expression (hCLDN6+++/++)
Antibody Function anti-hCLDN6 antibody Ab2 bound to Human gastric cancer cell lineNUGC-3 (JCRB cell bank) expressing CLDN7
Antibody Antigen Binding Assay Human gastric cancer cell line NUGC-3 (JCRB cell bank) expressing CLDN6 were suspended with PBS containing 5% FBS so as to have a concentration of 1x10°Cells/mL. Thesuspension was seeded (added) in the wells of a 96-well V-bottom microplate at a rate of 100 uL/well. After cen-trifugation, the supernatant was removed. AbM: antibodycomprising a heavy chain, aCLDN6-VH-CH,-CH,-CH, and a light chain, aCLDN6-VL-CL, disclosed in Inter-national Publication No. WO2022/058298. Ab0O, Ab] andAb2 were suspended with 5% FBS-containing PBS such thatthe concentrations fall in the range of 1 ng/mL to 25 ng/mL (12 dilution series were prepared by serial dilution at a2.5-fold dilution rate from 25 ug/mL to 1 ng/mL). Thesuspensions were added at a rate of 100 wL/well and allowedto stand still at 4°C. for one hour. PE-F (ab'), Goat anti-human IgG (JACKSON, #109-006-098 were diluted 100-fold with 5% FBS-containing PBS. The diluted solution was used to dilute Zombie NIR Fixable Viability Kit (Biolegend,#423106) 200-fold to prepare a secondary-antibody solu-tion. Washing was carried out twice with 5% FBS-contain-ing PBS and the secondary-antibody solution prepared wasadded at a rate of 100 wL/well and allowed to stand still at4°C. for one hour. After washing was carried out twice with5% FBS-containing PBS, resuspension was carried out with5% FBS-containing PBS. Detection was carried out. A histogram of PE (phycoerythrin) fluorescence intensity of viable cell frac-tions was prepared and geometric mean fluorescence inten-sity (gMFI) was calculated.
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
US20250025567A1 ExL1A2 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data The ADC concentration required to produce 10,000 pg/mL TNF-alpha was evaluated. > 1000 nM Positive CLDN6 expression (CLDN6+++/++)
Method Description
ExL1A2 was tested in co-culture system consisting of Human peripheral blood mononuclear cells (PBMCs) and NUGC33 cells, with the concentration range of 5.5 uM to 0.97 uM,TNF-a and INF-y productions were measured.
In Vitro Model Normal; Gastric adenocarcinoma PBMC cells; NUGC3 cells .;CVCL_1612
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data The ADC concentration required to produce 10,000 pg/mL INF-Gamma was evaluated.
100- 1000 nM
Positive CLDN6 expression (CLDN6+++/++)
Method Description
ExL1A2 was tested in co-culture system consisting of Human peripheral blood mononuclear cells (PBMCs) and NUGC33 cells, with the concentration range of 5.5 uM to 0.97 uM,TNF-a and INF-y productions were measured.
In Vitro Model Normal; Gastric adenocarcinoma PBMC cells; NUGC3 cells .;CVCL_1612
References
Ref 1 Antibody-drug complex containing Toll-like receptor 7/8 dual agonist compound