Antibody Information
General Information of This Antibody (ID: ANTI0FIPFF)
| Antibody Name | pamlectabart |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | BCMA |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWISWVRQAPGKGLVWVGEINPSSSTINY
APSLKDKFTISRDNAKNTLYLQMNSLRAEDTAVYYCASLYYDYGDAYDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVCVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
EVQLVESGGGLVQPGGSLRLSCAASGFTFSRYWISWVRQAPGKGLVWVGEINPSSSTINY
APSLKDKFTISRDNAKNTLYLQMNSLRAEDTAVYYCASLYYDYGDAYDYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVCVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVMTQSPATLSVSPGERATLSCKASQSVESNVAWYQQKPGQAPRALIYSASLRFSGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNYPLTFGAGTKLELKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
EIVMTQSPATLSVSPGERATLSCKASQSVESNVAWYQQKPGQAPRALIYSASLRFSGIPA
RFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNYPLTFGAGTKLELKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Pamlectabart tismanitin [Phase 1/2]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligibility requires adults (≥18) with IMWG-defined active MM after ≥3 prior lines (IMiD/PI/anti-CD38) who are transplant-ineligible/post-SCT, excluding those with plasma cell leukemia, active CNS/other malignancies, uncontrolled infections (HIV/HBV/HCV), or recent SCT/radiotherapy (<12/<21 weeks). Phase 2a specifically excludes prior BCMA-targeted therapy exposure.
Click to Show/Hide
|
||||
| Administration Dosage |
Participants will receive HDP-101 intravenously in a 21 day cycle until disease progression, intolerable toxicity, Investigator's discretion or patient withdrawal.During the phase 1 tolerability of different dose levels will be evaluated. During the phase 2a dose expansion part the recommended phase 2 dose (RP2D) of HDP-101 will be administered.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04879043 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase 1/2a, First-in-human Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of HDP-101 in Patients With Plasma Cell Disorders Including Multiple Myeloma
|
||||
| Primary Endpoint |
Primary endpoints evaluate safety (dose-limiting toxicities during first 21-day cycle) and efficacy (objective response rate per IMWG criteria including sCR/CR/VGPR/PR) in relapsed/refractory multiple myeloma patients over approximately 1 year.
|
||||
| Other Endpoint |
Secondary objectives include comprehensive safety assessment (CTCAE v5.0 graded AEs) and clinical activity measures (PFS/OS) to characterize HDP-101's therapeutic profile, with all endpoints monitored throughout the 1-year study duration.
|
||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.01 nM
|
|||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Plasma cell myeloma | U266B1 cells | CVCL_0566 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.04 nM
|
|||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.16 nM
|
|||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.18 nM
|
|||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Plasma cell myeloma | INA-6 cells | CVCL_5209 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.3 nM
|
|||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Plasma cell myeloma | LP-1 cells | CVCL_0012 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.34 nM
|
|||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Multiple myeloma | SK-MM-1 cells | CVCL_A478 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
4.83 nM
|
|||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Plasma cell myeloma | L-363 cells | CVCL_1357 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
34.2 nM
|
|||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Plasma cell myeloma | OPM-2 cells | CVCL_1625 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
142 nM
|
|||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Plasma cell myeloma | RPMI-8226 cells | CVCL_0014 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 1000 nM | |||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Osteosarcoma | U2OS cells | CVCL_0042 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 1000 nM | |||
| Method Description |
The inhibitory activity of HDP-101 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 2 or 4 days.
|
||||
| In Vitro Model | Normal | HS-5 cells | CVCL_3720 | ||
References