General Information of This Antibody (ID: ANI0VELIR)
Antibody Name
Lorvotuzumab
Organization
ImmunoGen, Inc.
Indication
Wilms tumor
Synonyms
huN901
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Neural cell adhesion molecule 1 (NCAM1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSFGMHWVRQAPGKGLEWVAYISSGSFTIYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARMRKGYAMDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DVVMTQSPLSLPVTLGQPASISCRSSQIIIHSDGNTYLEWFQQRPGQSPRRLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPHTFGQGTKVEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Lorvotuzumab mertansine [Phase 2 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 7 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Eligible patients include adults (≥18) with CD56+ hematologic malignancies (AML, high-risk MDS, NK leukemia, ALL, CML blast phase, MF, or BPDCN) refractory to prior therapies, ECOG ≤2, adequate organ function, and proper contraception. Exclusions: IMGN901 allergy/hypersensitivity, active CNS disease, grade ≥3 neuropathy, uncontrolled cardiac/pulmonary/pancreatic conditions, recent major surgery, pregnancy, or protocol non-compliance. Reproductive-age participants must use dual contraception.

   Click to Show/Hide
Administration Dosage
100 mg/m2 by vein on Day 1 and 8 of a 21-day cycle.
Related Clinical Trial
NCT Number NCT02420873  Clinical Status PHASE2
Clinical Description
An Open-label Phase II Study of Lorvotuzumab Mertansine (IMGN901) in CD56 Expressing Hematological Malignancies
Primary Endpoint
The primary endpoint is Overall Response Rate (ORR) to IMGN901 in CD56+ hematological malignancies, defined as Complete Remission (CR + CRp + CRi) achieved within three cycles (53-day evaluation).
Other Endpoint
Secondary data collection focuses on safety monitoring but specific endpoints were not predefined in the provided information.
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligible patients must have histologically confirmed, relapsed/refractory CD56+ multiple myeloma (≥1 prior therapy, ≤6 regimens at MTD). Key inclusion: ECOG 0-2, adequate organ function, life expectancy ≥12 weeks, no severe neuropathy, cardiac disease, pancreatitis, or active infections. Exclusion: recent stroke, malignancies (except certain in situ cancers), uncontrolled comorbidities, or prior hypersensitivity to monoclonal antibodies. Prior therapy washout: ≥4 weeks for chemo/RT/surgery, ≥2 weeks for biologics. Concurrent bisphosphonates allowed if stable; steroids restricted to specific indications.

   Click to Show/Hide
Administration Dosage
dose escalation study, doses will vary per cohort. patients will receive an IV infusion weekly for two weeks every three weeks.
Related Clinical Trial
NCT Number NCT00346255  Clinical Status PHASE1
Clinical Description
A Phase I Study to Assess The Safety and Pharmacokinetics of BB-10901 (huN901-DM1) Given as an Intravenous Infusion Weekly for Two Consecutive Weeks Every Three Weeks to Subjects With Relapsed and Relapsed Refractory CD56-Positive Multiple Myeloma
Primary Endpoint
This study evaluates dose-limiting toxicity (through cycle 1) and maximum tolerated dose (for the duration of the study).
Other Endpoint
Assessed endpoints include qualitative/quantitative toxicities, pharmacokinetics, and anti-tumor activity (response rate, progression-free survival, overall survival), all measured for the duration of the study.
Experiment 3 Reporting the Activity Date of This ADC [3]
Patients Enrolled
Eligible patients must be ≥18 years, have ECOG ≤2, meet CD56-positive criteria, and have received 1-3 prior regimens (including lenalidomide/bortezomib if applicable). Exclusions include active infections, significant cardiac disease, recent chemotherapy/radiation, neuropathy ≥grade 2, or inadequate organ function (ANC ≥1000, platelets ≥50K, creatinine ≤1.5x ULN). Strict contraception and compliance with RevAssist® are mandated.

   Click to Show/Hide
Administration Dosage
dose escalation study. dosing on days 1, 8 and 15 every 28 days
Related Clinical Trial
NCT Number NCT00991562  Clinical Status PHASE1
Clinical Description
An Open-Label Phase I Study of Bb-10901 (IMGN901, huN901-DM10 in Combination With Lenalidomide and Dexamethasone in Patients With CD56-positive Relapsed or Relapsed/Refractory Multiple Myeloma
Primary Endpoint
The study aims to determine the MTD/RPTD and assess the response rate of the combination therapy in patients with CD56-positive relapsed/refractory multiple myeloma, evaluating efficacy through objective response rate, duration of responses, progression-free survival, and overall survival.
Other Endpoint
Key pharmacodynamic outcomes and safety parameters, including ORR, CR rates, time to progression, and survival metrics, will be monitored throughout the study duration.
Experiment 4 Reporting the Activity Date of This ADC [4]
Patients Enrolled
Eligible patients (age &ge;1, Karnofsky/Lansky &ge;50) must have measurable disease (exceptions: MIBG-avid neuroblastoma), prior standard therapy, and adequate organ function (ANC &ge;750-1000/uL, platelets &ge;75K-100K/uL, GFR &ge;70 mL/min). Exclusions include active CNS metastases, neuropathy &ge;grade 2, uncontrolled infections, recent chemotherapy (<3 weeks), pregnancy, or prior IMGN901 exposure. Reproductive-age participants must use contraception.

   Click to Show/Hide
Administration Dosage
Patients receive lorvotuzumab mertansine IV over 1-1.5 hours on days 1 and 8. Treatment repeats every 21 days for up to 17 courses in the absence of disease progression or unacceptable toxicity.
Related Clinical Trial
NCT Number NCT02452554  Clinical Status PHASE2
Clinical Description
A Phase 2 Study of IMGN901 (Lorvotuzumab Mertansine; NSC#: 783609) in Children With Relapsed or Refractory Wilms Tumor, Rhabdomyosarcoma, Neuroblastoma, Pleuropulmonary Blastoma, Malignant Peripheral Nerve Sheath Tumor (MPNST) and Synovial Sarcoma
Primary Endpoint
The study evaluates objective response rates (ORR) per RECIST v1.1 in pediatric/adolescent solid tumors (Wilms tumor, rhabdomyosarcoma, neuroblastoma, and other CD56+ malignancies), assessing partial/complete responses over 18 weeks. Toxicity profiles of lorvotuzumab mertansine will be monitored via NCI CTCAE v4.0 for 12 months.
Other Endpoint
Key endpoints focus on response stratification and safety, with Clopper-Pearson confidence intervals for ORR and detailed toxicity summaries by cycle and attribution.
Experiment 5 Reporting the Activity Date of This ADC [5]
Patients Enrolled
Eligible patients were &ge;18 years with untreated extensive-stage SCLC (ECOG 0-2). Exclusion criteria included pregnancy/lactation and prior SCLC chemotherapy. The control arm served primarily for safety validation rather than powered efficacy comparisons.
Administration Dosage
Phase 2 regimen is IMGN901, Carboplatin, and Etoposide. IMGN901 to be given on days 1 and 8 every 21 days.
Related Clinical Trial
NCT Number NCT01237678  Clinical Status PHASE1|||PHASE2
Clinical Description
A Phase 1/2 Study to Assess the Safety and Efficacy of Lorvotuzumab Mertansine in Combination With Carboplatin/Etoposide in Patients With Advanced Solid Tumors Including Extensive Stage Small Cell Lung Cancer
Primary Endpoint
The primary Phase I objective was determining the MTD of IMGN901 in combination with carboplatin/etoposide for solid tumors, with DLTs assessed during Cycle 1 (21 days), including febrile neutropenia, grade ≥3 toxicities, and treatment-delaying events. Phase II focused on PFS in extensive-stage SCLC patients comparing the IMGN901 triplet regimen against historical carboplatin/etoposide controls.

   Click to Show/Hide
Other Endpoint
Safety profiles were evaluated through TEAEs/SAEs (CTCAE v4.0-graded) until 28 days post-treatment. Secondary efficacy metrics included 6-month PFS rates (experimental arm vs historical 44% benchmark) and median OS, though statistical comparisons were limited by study design.
Experiment 6 Reporting the Activity Date of This ADC [6]
Patients Enrolled
Prior therapy restrictions: &le;3 chemotherapy lines (ovarian patients require platinum exposure), no recent radiotherapy/immunotherapy (4-week washout), and anthracycline doses below cardiotoxicity thresholds. Concurrent antineoplastic treatments are prohibited.
Administration Dosage
dose escalation study, dose will vary per cohort. patients will receive an IV infusion once every three weeks.
Related Clinical Trial
NCT Number NCT00346385  Clinical Status PHASE1
Clinical Description
A Phase I, Open-Label, Dose Escalation Study of Daily Dosing With BB-10901
Primary Endpoint
Safety and pharmacokinetic assessments will evaluate toxicity (via prothrombin time tests) and IMGN901 conjugate/antibody levels during Cycle 1 (21 days), while efficacy focuses on tumor response rates and neuroendocrine biomarkers (neuron-specific enolase/NCAM) measured every 2 cycles.
Other Endpoint
Eligible patients (ECOG 0-2, life expectancy ≥3 months) include relapsed/refractory SCLC (1-3 prior regimens), CD56+ neuroendocrine tumors, and select carcinomas (Merkel cell/ovarian). Key exclusions: uncontrolled metastases, significant cardiorespiratory comorbidities, active infections, or pancreatitis risk factors (elevated LFTs/pancreatic enzymes).

   Click to Show/Hide
Experiment 7 Reporting the Activity Date of This ADC [7]
Efficacy Data Objective Response Rate (ORR)
28.30%
Positive CD56 expression (CD56+++/++)
Patients Enrolled
Relapsed and/or Refractory CD-56-positive Multiple Myeloma.
Administration Dosage
40 mg/m2 (up to a maximum of 140 mg) intravenously once every 3 weeks.
Related Clinical Trial
NCT Number NCT00346255  Clinical Status Phase 1
Clinical Description
BB-10901 in treating patients with relapsed and/or refractory multiple myeloma (IMGN901).
Primary Endpoint
Objective response rate=28.30%.
Other Endpoint
Median progression-free survival=26.10 months (95% CI 1-89 weeks).
References
Ref 1 An Open-label Phase II Study of Lorvotuzumab Mertansine
Ref 2 BB-10901 in Treating Patients With Relapsed and/or Refractory Multiple Myeloma
Ref 3 IMGN901 in Combination With Lenalidomide and Dexamethasone
Ref 4 Lorvotuzumab Mertansine in Treating Younger Patients With Relapsed or Refractory Wilms Tumor, Rhabdomyosarcoma, Neuroblastoma, Pleuropulmonary Blastoma, Malignant Peripheral Nerve Sheath Tumor, or Synovial Sarcoma
Ref 5 Phase 1/2 Study of the CD56-Targeting Antibody-Drug Conjugate Lorvotuzumab Mertansine (IMGN901) in Combination With Carboplatin/Etoposide in Small-Cell Lung Cancer Patients With Extensive-Stage Disease
Ref 6 BB-10901 in Treating Patients With Relapsed or Refractory Solid Tumors
Ref 7 A Phase I Study to Assess the Safety and Pharmacokinetics of Single-agent Lorvotuzumab Mertansine (IMGN901) in Patients with Relapsed and/or Refractory CD-56-positive Multiple Myeloma. Clin Lymphoma Myeloma Leuk. 2019 Jan;19(1):29-34. doi: 10.1016/j.clml.2018.08.018. Epub 2018 Sep 5.