Antibody Information
General Information of This Antibody
| Antibody ID | ANI0QYT011 |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Emiltatug |
|||||
| Organization | Mersana Therapeutics, Inc. |
|||||
| Synonyms |
Emiltatug
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | V-set domain-containing T-cell activation inhibitor 1 (VTCN1) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLIQPGGSLRLSCAASGFIVSRNYMNWVRQAPGKGLEWVSVIYGSGRTDSA
DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDADYGLDVWGQGTTVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPLYTFGQGTKLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Emiltatug ledadotin [Phase 1]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligible patients (ECOG 0-1) have recurrent/advanced solid tumors (measurable per RECIST 1.1) and available tumor tissue. Key exclusions: prior auristatin-ADC treatment, untreated CNS metastases, active liver disease (cirrhosis/varices), uncontrolled systemic illness, or recent anticancer therapy/surgery (within specified washout periods). Brain MRI is required for TNBC or symptomatic/metastatic CNS history.
Click to Show/Hide
|
||||
| Administration Dosage |
XMT-1660 will be administered through a vein in your arm or port catheter (intravenously)
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT05377996 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, First-in-human, Dose Escalation and Expansion, Multicenter Study of XMT-1660 in Participants With Solid Tumors
|
||||
| Primary Endpoint |
The Phase 1 study evaluates DLTs within the first treatment cycle (17 months) to establish MTD/RP2D for XMT-1660, with safety/tolerability assessed via AEs over 3 years. Phase 2 expansion measures ORR per RECIST 1.1 (investigator-assessed CR/PR rates).
|
||||
| Other Endpoint |
Secondary endpoints include ORR (dose escalation), DOR (time to progression/death), and comprehensive PK analysis (Tmax, Cmax, AUC, clearance, half-life, volume of distribution, Ctrough) over 3 years. Immunogenicity (ADA/nAb development) is monitored throughout both phases.
|
||||