Antibody ID	ANI0OXDFY
Antibody Name	Indatuximab
Organization	Biotest AG; Biotest Pharma GmbH
Indication	Multiple Myeloma; Bladder cancer; Breast cancer
Synonyms	nBT062    Click to Show/Hide
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Chimeric IgG4-kappa
Antigen Name	Syndecan-1 (SDC1)					Antigen Info
ChEMBI ID	CHEMBL1743031
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	QVQLQQSGSELMMPGASVKISCKATGYTFSNYWIEWVKQRPGHGLEWIGEILPGTGRTIY NEKFKGKATFTADISSNTVQMQLSSLTSEDSAVYYCARRDYYGNFYYAMDYWGQGTSVTV SSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEM TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ EGNVFSCSVMHEALHNHYTQKSLSLSLGK     Click to Show/Hide
Light Chain Sequence	DIQMTQSTSSLSASLGDRVTISCSASQGINNYLNWYQQKPDGTVELLIYYTSTLQSGVPS RFSGSGSGTDYSLTISNLEPEDIGTYYCQQYSKLPRTFGGGTKLEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC     Click to Show/Hide

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Objective Response Rate (ORR)	3.20% (on the single-dose regimen) 5.90% (the multi-dose regimen)
Patients Enrolled	Relapsed and/or refractory multiple myeloma (MM) previously treated with an immunomodulatory drug and a proteasome inhibitor.
Administration Dosage	In the first-in-human study, indatuximab ravtansine (10, 20, 40, 80, 120, 160, 200 mg/m2) was administered to 32 patients on day 1 of each 21-day cycle. The MTD was 160 mg/m2. In the phase I/IIa study, indatuximab ravtansine (40, 50, 65, 80, 100, 120, 140, 160 mg/m2) was administered to 35 patients on days 1, 8, and 15 of each 28-day cycle, and the MTD/recommended phase II dose was 140 mg/m2.    Click to Show/Hide
Related Clinical Trial
NCT Number	NCT00723359	Clinical Status	Phase 1
Clinical Description	A phase 1 dose escalation study to evaluate maximum tolerated dose (MTD), pharmacokinetics (PK), and safety of BT062 in subjects with relapsed or relapsed/refractory multiple myeloma.
Primary Endpoint	The 160 mg/m2 dose was therefore defined as MTD for the Single-dose Regimen.
Other Endpoint	Most (88.00%) adverse events were grade 1 or 2, the most common being diarrhea and fatigue. There was rapid clearance of indatuximab ravtansine and no relevant accumulation.
Experiment 2 Reporting the Activity Date of This ADC					[2]
Patients Enrolled	Relapsed or refractory multiple myeloma, and ECOG performance status or Zubrod score of 2 or below.
Administration Dosage	Intravenously on days 1, 8, and 15 of each 28-day cycle in escalating dose levels of 80 mg/m2, 100 mg/m2, and 120 mg/m2, with lenalidomide (25 mg; days 1 to 21 every 28 days orally) and dexamethasone (20-40 mg; days 1, 8, 15, and 22 every 28 days) (phase 1).
Related Clinical Trial
NCT Number	NCT01638936	Clinical Status	Phase 1
Clinical Description	A phase 1/2a multi-dose escalation study of BT062 in combination with lenalidomide or pomalidomide and dexamethasone in subjects with relapsed or relapsed/refractory multiple myeloma.

Experiment 1 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 0.00% (Day 39)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 1 mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF1384)
Experiment 2 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 0.00%	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 2 mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF1384)
Experiment 3 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 0.00% (Day 39)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 4 mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF1384)
Experiment 4 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 25.00% (Day 38)	High CD138 expression (CD138+++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 1 mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF401)
Experiment 5 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 55.00% (Day 38)	High CD138 expression (CD138+++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 2 mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF401)
Experiment 6 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 55.00% (Day 39)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine combination docetaxel against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated docetaxel with 10 mg/kg and treated indatuximab ravtansine with 2 mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF1384)
Experiment 7 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 70.00% (Day 39)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 8mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF1384)
Experiment 8 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 95.50% (Day 38)	High CD138 expression (CD138+++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 4 mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF401)
Experiment 9 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 99.80% (Day 38)	High CD138 expression (CD138+++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 8mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF401)
Experiment 10 Reporting the Activity Date of This ADC					[3]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 100.00% (Day 38)	High CD138 expression (CD138+++)
Method Description	The inhibitory activity of indatuximab ravtansine combination docetaxel against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated docetaxel with 10 mg/kg and treated indatuximab ravtansine with 2 mg/kg.
In Vivo Model	Triple-negative breast cancer PDX model (PDX: MAXF401)

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 38.86% (Day 14)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine combination lenalidomide against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 5.3 mg/kg body weight for 14 days.
In Vivo Model	Multiple myeloma CDX model
In Vitro Model	Multiple myeloma	Multiple myeloma cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 40.42% (Day 17)	High CD138 expression (CD138+++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 2 mg/kg/day.
In Vitro Model	Plasma cell myeloma	MMXF L363 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 50.00% (Day 14)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 5.3 mg/kg body weight for 14 days.
In Vivo Model	Multiple myeloma CDX model
In Vitro Model	Multiple myeloma	Multiple myeloma cells		Homo sapiens
Experiment 4 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 55.69% (Day 14)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine combination lenalidomide against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 10.6 mg/kg body weight for 14 days.
In Vivo Model	Multiple myeloma CDX model
In Vitro Model	Multiple myeloma	Multiple myeloma cells		Homo sapiens
Experiment 5 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 59.90% (Day 14)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 10.6 mg/kg body weight for 14 days.
In Vivo Model	Multiple myeloma CDX model
In Vitro Model	Multiple myeloma	Multiple myeloma cells		Homo sapiens
Experiment 6 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 65.34% (Day 14)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 21.2 mg/kg body weight for 14 days.
In Vivo Model	Multiple myeloma CDX model
In Vitro Model	Multiple myeloma	Multiple myeloma cells		Homo sapiens
Experiment 7 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 77.26% (Day 17)	High CD138 expression (CD138+++)
Method Description	The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 4 mg/kg/day.
In Vitro Model	Plasma cell myeloma	MMXF L363 cells		Homo sapiens
Experiment 8 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 77.27% (Day 17)	High CD138 expression (CD138+++)
Method Description	The inhibitory activity of indatuximab ravtansine+lenalidomide (Len; 20 mg/kg/day) and dexamethasone (1.25 mg/kg/day) against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated IR with 2 mg/kg/day.
In Vitro Model	Breast ductal carcinoma	JIMT-1 cells		CVCL_2077
Experiment 9 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 79.20% (Day 14)	Moderate CD138 expression (CD138++)
Method Description	The inhibitory activity of indatuximab ravtansine combination lenalidomide against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 21.2 mg/kg body weight for 14 days.
In Vivo Model	Multiple myeloma CDX model
In Vitro Model	Multiple myeloma	Multiple myeloma cells		Homo sapiens
Experiment 10 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 92.05% (Day 17)	High CD138 expression (CD138+++)
Method Description	The inhibitory activity of indatuximab ravtansine+lenalidomide (Len; 20 mg/kg/day) and dexamethasone (1.25 mg/kg/day) against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated IR with 4 mg/kg/day.
In Vitro Model	Breast ductal carcinoma	JIMT-1 cells		CVCL_2077

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 100.00% (Day 56)	Positive CD138 expression (CD138+++/++)
Method Description	Wild type nBT062-DM4 (4 mg/kg/week for three injections in total) induces efficient tumor cell killing in models of MAXF1322 mammary carcinoma cells with CD138 expression with high expression.
In Vivo Model	Breast cancer PDX model (PDX: MAXF 1322)

Experiment 1 Reporting the Activity Date of This ADC					[5]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.10 nM±0.02 nM	Positive CD138 expression (CD138+++/++)
Method Description	WT nBT062-DM4, stable nBT062-DM4, half nBT062-DM4 or bispecific nBT062-natalizumab-DM4 were added to the cells. Cells were incubated and after 5 days the viability was determined using the WST-1 cell proliferation assay.
In Vitro Model	Plasma cell myeloma	NCI-H929 cells		CVCL_1600

Experiment 1 Reporting the Activity Date of This ADC					[6]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 56.56% (Day 26)
Method Description	The inhibitory activity of nBT062-SPDB-DM4 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 100g/kg.
In Vivo Model	SCID-hu MM model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 2 Reporting the Activity Date of This ADC					[6]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 87.92% (Day 26)
Method Description	The inhibitory activity of nBT062-SPDB-DM4 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 250g/kg.
In Vivo Model	SCID-hu MM model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 3 Reporting the Activity Date of This ADC					[6]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 95.00% (Day 26)
Method Description	The inhibitory activity of nBT062-SPDB-DM4 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 450g/kg.
In Vivo Model	SCID-hu MM model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124

Experiment 1 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 77.61% (Day 30)	Positive CD138 expression (CD138 +++/++)
Method Description	MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg.
In Vivo Model	MOLP-8 CDX model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 2 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 84.27% (Day 20)	Positive CD138 expression (CD138 +++/++)
Method Description	MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg.
In Vivo Model	MOLP-8 CDX model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 3 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 92.11% (Day 30)	Positive CD138 expression (CD138 +++/++)
Method Description	MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 450 ug/kg.
In Vivo Model	MOLP-8 CDX model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124

Experiment 1 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	1.00 nM-10.00 nM	Positive CD138 expression (CD138 +++/++)
Method Description	CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 2 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	> 100 nM	Negative CD138 expression (CD138 -)
Method Description	CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
In Vitro Model	Burkitt lymphoma	BJAB cells		CVCL_5711

Experiment 1 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 78.02% (Day 30)	Positive CD138 expression (CD138 +++/++)
Method Description	MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg.
In Vivo Model	MOLP-8 CDX model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 2 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 93.32% (Day 30)	Positive CD138 expression (CD138 +++/++)
Method Description	MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg per week (five weeks).
In Vivo Model	MOLP-8 CDX model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 3 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 94.27% (Day 30)	Positive CD138 expression (CD138 +++/++)
Method Description	MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 450 ug/kg.
In Vivo Model	MOLP-8 CDX model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124

Experiment 1 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.10 nM-1.00 nM	Positive CD138 expression (CD138 +++/++)
Method Description	CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 2 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	> 100 nM	Negative CD138 expression (CD138 -)
Method Description	CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
In Vitro Model	Burkitt lymphoma	BJAB cells		CVCL_5711

Experiment 1 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Tumor Growth Inhibition value (TGI)	≈ 96.40% (Day 20)	Positive CD138 expression (CD138 +++/++)
Method Description	MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg.
In Vivo Model	MOLP-8 CDX model
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124

Experiment 1 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.10 nM-1.00 nM	Positive CD138 expression (CD138 +++/++)
Method Description	CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
In Vitro Model	Plasma cell myeloma	MOLP-8 cells		CVCL_2124
Experiment 2 Reporting the Activity Date of This ADC					[7]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	> 100 nM	Negative CD138 expression (CD138 -)
Method Description	CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
In Vitro Model	Burkitt lymphoma	BJAB cells		CVCL_5711

Experiment 1 Reporting the Activity Date of This ADC					[8]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	35.70 pM	Positive CD38 expression (CD38+++/++)
Method Description	Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model	Plasma cell myeloma	OPM-2 cells		CVCL_1625
Experiment 2 Reporting the Activity Date of This ADC					[8]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	52.60 pM	Positive CD38 expression (CD38+++/++)
Method Description	Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model	Plasma cell myeloma	MM1.S cells		CVCL_8792
Experiment 3 Reporting the Activity Date of This ADC					[8]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	90.60 pM	Positive CD38 expression (CD38+++/++)
Method Description	Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model	Plasma cell myeloma	MOLP-2 cells		CVCL_2123
Experiment 4 Reporting the Activity Date of This ADC					[8]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.12 nM	Positive CD38 expression (CD38+++/++)
Method Description	Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model	Plasma cell myeloma	MM1.R cells		CVCL_8794
Experiment 5 Reporting the Activity Date of This ADC					[8]
Efficacy Data	Half Maximal Inhibitory Concentration (IC50)	0.36 nM	Positive CD38 expression (CD38+++/++)
Method Description	Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
In Vitro Model	Plasma cell myeloma	KMS-12-BM cells		CVCL_1334

Ref 1	Indatuximab Ravtansine (BT062) Monotherapy in Patients With Relapsed and/or Refractory Multiple Myeloma. Clin Lymphoma Myeloma Leuk. 2019 Jun;19(6):372-380.
Ref 2	Indatuximab ravtansine plus dexamethasone with lenalidomide or pomalidomide in relapsed or refractory multiple myeloma: a multicentre, phase 1/2a study. Lancet Haematol. 2021 Nov;8(11):e794-e807.
Ref 3	Activity of Indatuximab Ravtansine against Triple-Negative Breast Cancer in Preclinical Tumor Models. Pharm Res. 2018 Apr 17;35(6):118.
Ref 4	Indatuximab ravtansine (BT062) combination treatment in multiple myeloma: pre-clinical studies. J Hematol Oncol. 2017 Jan 11;10(1):13.
Ref 5	Functional relevance of in vivo half antibody exchange of an IgG4 therapeutic antibody-drug conjugate. PLoS One. 2018 Apr 19;13(4):e0195823. doi: 10.1371/journal.pone.0195823. eCollection 2018.
Ref 6	The monoclonal antibody nBT062 conjugated to cytotoxic Maytansinoids has selective cytotoxicity against CD138-positive multiple myeloma cells in vitro and in vivo. Clin Cancer Res. 2009 Jun 15;15(12):4028-37.
Ref 7	Immunoconjugates targeting cd138 and uses thereof; 2009-07-02.
Ref 8	Neodegrader conjugates; 2021-10-07.