Antibody Information
General Information of This Antibody (ID: ANI0OXDFY)
| Antibody Name | Indatuximab |
|||||
|---|---|---|---|---|---|---|
| Organization | Biotest AG; Biotest Pharma GmbH |
|||||
| Indication | Multiple Myeloma; Bladder cancer; Breast cancer |
|||||
| Synonyms |
nBT062
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Chimeric IgG4-kappa |
|||||
| Antigen Name | Syndecan-1 (SDC1) |
Antigen Info | ||||
| ChEMBI ID | ||||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLQQSGSELMMPGASVKISCKATGYTFSNYWIEWVKQRPGHGLEWIGEILPGTGRTIY
NEKFKGKATFTADISSNTVQMQLSSLTSEDSAVYYCARRDYYGNFYYAMDYWGQGTSVTV SSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEM TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ EGNVFSCSVMHEALHNHYTQKSLSLSLGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSTSSLSASLGDRVTISCSASQGINNYLNWYQQKPDGTVELLIYYTSTLQSGVPS
RFSGSGSGTDYSLTISNLEPEDIGTYYCQQYSKLPRTFGGGTKLEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Indatuximab ravtansine [Phase 1/2 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
71.7
70.6 % |
|||
| Patients Enrolled |
Eligible relapsed/refractory myeloma patients (≥18 years, ECOG ≤2) must have failed prior therapies (1+ for Len/Dex arm, 2+ for Pom/Dex arm) and comply with REMS programs. Exclusions include recent chemotherapy/radiotherapy (3-6 weeks), active HBV/HCV/HIV, cardiac abnormalities, pregnancy, prior BT062 exposure, or hypersensitivity to biologics. Plasma cell leukemia and recent thromboembolic events (DVT/PE within 3 months) are prohibited.
Click to Show/Hide
|
||||
| Administration Dosage |
BT062 administered intravenously on days 1, 8 and 15 of each 28-day cycle, and lenalidomide or pomalidomide and dexamethasone administered orally to subjects with relapsed or relapsed/refractory MM
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT01638936 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase I/IIa Multi-dose Escalation Study of BT062 in Combination With Lenalidomide or Pomalidomide and Dexamethasone in Subjects With Relapsed or Relapsed/Refractory Multiple Myeloma
|
||||
| Primary Endpoint |
The study consists of two phases: Phase I (6 months) determines the optimal dose of BT062 combined with lenalidomide/dexamethasone using a standard 3+3 dose escalation design focused on DLTs in cycle 1; Phase IIa (18 months) evaluates treatment response using M-protein and serum free light chain assessments at each 28-day cycle, with supplementary bone marrow/skeletal exams as needed.
Click to Show/Hide
|
||||
| Other Endpoint |
Safety will be monitored for 24 months via adverse events, clinical labs, and vital signs. Pharmacokinetics of BT062 and its metabolite (DM4) will be analyzed, alongside time-to-event endpoints (TTP, PFS, TTNT, DOR, OS). Quantitative toxicities will track treatment-emergent changes in clinical parameters.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Eligible participants must have relapsed/refractory multiple myeloma, prior exposure to immunomodulators/proteasome inhibitors, ECOG ≤2, and adequate organ function. Exclusions include recent chemotherapy/radiotherapy (within 3-6 weeks), active infections (HBV/HCV/HIV), uncontrolled cardiac disease, pregnancy, or concurrent antineoplastic therapies. The study prohibits recent major surgery, investigational agents within 4 weeks, and prior MAb therapy with detectable immune responses (HAHA/HACA/HAMA).
Click to Show/Hide
|
||||
| Administration Dosage |
BT062 single agent dose escalation
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT00723359 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase I Dose Escalation Study to Evaluate Maximum Tolerated Dose (MTD), Pharmacokinetics (PK), and Safety of BT062 in Subjects With Relapsed or Relapsed/Refractory Multiple Myeloma
|
||||
| Primary Endpoint |
The study evaluates dose-limiting toxicities (DLTs) assessed weekly and maximum tolerated dose (MTD) assessed every two months over the study duration for participants with relapsed/refractory multiple myeloma. Safety monitoring focuses on identifying the highest tolerable dose with manageable toxicity profiles.
|
||||
| Other Endpoint |
Weekly assessments include qualitative and quantitative toxicities, pharmacokinetic profiling, and anti-tumor activity evaluated at each treatment cycle initiation. Efficacy is measured through tumor response criteria, while pharmacokinetic data capture drug exposure and metabolic profiles to guide dosing adjustments.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible participants had relapsed/refractory myeloma with prior immunomodulator/proteasome inhibitor exposure, ECOG ≤2, and adequate organ function. Exclusions included recent chemotherapy/radiotherapy (3-6 weeks), active HBV/HCV/HIV, uncontrolled cardiac disease, prior BT062/HAMA/HAHA, or pregnancy. Concomitant antineoplastic therapies and high-dose corticosteroids were prohibited.
Click to Show/Hide
|
||||
| Administration Dosage |
BT062 was to be administered as single-dose IV infusions via a 0.22 um in-line filter preferably in a forearm vein, according to medically accepted procedures on Days 1, 8, and 15 of each 28-day cycle. Alternatively BT062 may have been administered through a central venous line or a peripherally inserted central catheter (PICC). Other administration routes were only to be allowed after approval from Biotest. Each subject was to be monitored carefully for the effects of exposure to BT062. No subject was to have received more than 3 doses of BT062 per 28-day treatment cycle.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT01001442 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase I/IIa Multi-Dose Escalation Study to Evaluate Maximum Tolerated Dose (MTD), Pharmacokinetics (PK), Safety and Efficacy of BT062 in Subjects With Relapsed or Relapsed/Refractory Multiple Myeloma
|
||||
| Primary Endpoint |
The study evaluated dose-limiting toxicities (DLTs) and maximum tolerated dose (MTD) for BT062 in relapsed/refractory multiple myeloma using a 3+3 dose escalation design. DLTs were assessed during the first 28-day cycle, and MTD was defined as the highest dose where <2 of 6 subjects experienced DLTs. Dose escalation stopped if ≥2 DLTs occurred at any level.
Click to Show/Hide
|
||||
| Other Endpoint |
Safety and efficacy assessments included qualitative/quantitative toxicities (TEAEs, SAEs), pharmacokinetic properties (Cmax of BT062 conjugate), and anti-tumor activity. Responses were graded per IMWG criteria (sCR, CR, VGPR, PR, MR, SD), with ORR (MR+PR+VGPR+CR+sCR) and CBR (ORR+SD) as key endpoints. Disease progression metrics (TTP, PFS, OS) tracked M-protein increases (≥25%), new lesions, or hypercalcemia.
Click to Show/Hide
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
3.20
5.90 % |
|||
| Patients Enrolled |
Relapsed and/or refractory multiple myeloma (MM) previously treated with an immunomodulatory drug and a proteasome inhibitor.
|
||||
| Administration Dosage |
In the first-in-human study, indatuximab ravtansine (10, 20, 40, 80, 120, 160, 200 mg/m2) was administered to 32 patients on day 1 of each 21-day cycle. The MTD was 160 mg/m2. In the phase I/IIa study, indatuximab ravtansine (40, 50, 65, 80, 100, 120, 140, 160 mg/m2) was administered to 35 patients on days 1, 8, and 15 of each 28-day cycle, and the MTD/recommended phase II dose was 140 mg/m2.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT00723359 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1 dose escalation study to evaluate maximum tolerated dose (MTD), pharmacokinetics (PK), and safety of BT062 in subjects with relapsed or relapsed/refractory multiple myeloma.
|
||||
| Primary Endpoint |
The 160 mg/m2 dose was therefore defined as MTD for the Single-dose Regimen.
|
||||
| Other Endpoint |
Most (88.00%) adverse events were grade 1 or 2, the most common being diarrhea and fatigue. There was rapid clearance of indatuximab ravtansine and no relevant accumulation.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Relapsed or refractory multiple myeloma, and ECOG performance status or Zubrod score of 2 or below.
|
||||
| Administration Dosage |
Intravenously on days 1, 8, and 15 of each 28-day cycle in escalating dose levels of 80 mg/m2, 100 mg/m2, and 120 mg/m2, with lenalidomide (25 mg; days 1 to 21 every 28 days orally) and dexamethasone (20-40 mg; days 1, 8, 15, and 22 every 28 days) (phase 1).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT01638936 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1/2a multi-dose escalation study of BT062 in combination with lenalidomide or pomalidomide and dexamethasone in subjects with relapsed or relapsed/refractory multiple myeloma.
|
||||
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 0% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 4 mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF1384) | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 0% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 2 mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF1384) | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 0% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 1 mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF1384) | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 25% | High CD138 expression (CD138+++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 1 mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF401) | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 55% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine combination docetaxel against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated docetaxel with 10 mg/kg and treated indatuximab ravtansine with 2 mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF1384) | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 55% | High CD138 expression (CD138+++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 2 mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF401) | ||||
| Experiment 7 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 70% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 8mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF1384) | ||||
| Experiment 8 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95.50% | High CD138 expression (CD138+++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 4 mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF401) | ||||
| Experiment 9 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 99.80% | High CD138 expression (CD138+++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 8mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF401) | ||||
| Experiment 10 Reporting the Activity Date of This ADC | [6] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100% | High CD138 expression (CD138+++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine combination docetaxel against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated docetaxel with 10 mg/kg and treated indatuximab ravtansine with 2 mg/kg.
|
||||
| In Vivo Model | Triple-negative breast cancer PDX model (PDX: MAXF401) | ||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 38.86% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine combination lenalidomide against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 5.3 mg/kg body weight for 14 days.
|
||||
| In Vivo Model | Multiple myeloma CDX model | ||||
| In Vitro Model | Multiple myeloma | Multiple myeloma cells | Homo sapiens | ||
| Experiment 2 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 40.42% | High CD138 expression (CD138+++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 2 mg/kg/day.
|
||||
| In Vitro Model | Plasma cell myeloma | MMXF L363 cells | Homo sapiens | ||
| Experiment 3 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 50% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 5.3 mg/kg body weight for 14 days.
|
||||
| In Vivo Model | Multiple myeloma CDX model | ||||
| In Vitro Model | Multiple myeloma | Multiple myeloma cells | Homo sapiens | ||
| Experiment 4 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 55.69% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine combination lenalidomide against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 10.6 mg/kg body weight for 14 days.
|
||||
| In Vivo Model | Multiple myeloma CDX model | ||||
| In Vitro Model | Multiple myeloma | Multiple myeloma cells | Homo sapiens | ||
| Experiment 5 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 59.90% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 10.6 mg/kg body weight for 14 days.
|
||||
| In Vivo Model | Multiple myeloma CDX model | ||||
| In Vitro Model | Multiple myeloma | Multiple myeloma cells | Homo sapiens | ||
| Experiment 6 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 65.34% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 21.2 mg/kg body weight for 14 days.
|
||||
| In Vivo Model | Multiple myeloma CDX model | ||||
| In Vitro Model | Multiple myeloma | Multiple myeloma cells | Homo sapiens | ||
| Experiment 7 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 77.26% | High CD138 expression (CD138+++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 4 mg/kg/day.
|
||||
| In Vitro Model | Plasma cell myeloma | MMXF L363 cells | Homo sapiens | ||
| Experiment 8 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 77.27% | High CD138 expression (CD138+++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine+lenalidomide (Len; 20 mg/kg/day) and dexamethasone (1.25 mg/kg/day) against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated IR with 2 mg/kg/day.
|
||||
| In Vitro Model | Breast ductal carcinoma | JIMT-1 cells | CVCL_2077 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 79.20% | Moderate CD138 expression (CD138++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine combination lenalidomide against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 21.2 mg/kg body weight for 14 days.
|
||||
| In Vivo Model | Multiple myeloma CDX model | ||||
| In Vitro Model | Multiple myeloma | Multiple myeloma cells | Homo sapiens | ||
| Experiment 10 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 92.05% | High CD138 expression (CD138+++) | ||
| Method Description |
The inhibitory activity of indatuximab ravtansine+lenalidomide (Len; 20 mg/kg/day) and dexamethasone (1.25 mg/kg/day) against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated IR with 4 mg/kg/day.
|
||||
| In Vitro Model | Breast ductal carcinoma | JIMT-1 cells | CVCL_2077 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.40% | Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg.
|
||||
| In Vivo Model | MOLP-8 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.1 nM
|
Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 100 nM | Negative CD138 expression (CD138 -) | ||
| Method Description |
CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
|
||||
| In Vitro Model | Burkitt lymphoma | BJAB cells | CVCL_5711 | ||
Wild type nBT062-DM4 [Investigative]
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 100% | Positive CD138 expression (CD138+++/++) | ||
| Method Description |
Wild type nBT062-DM4 (4 mg/kg/week for three injections in total) induces efficient tumor cell killing in models of MAXF1322 mammary carcinoma cells with CD138 expression with high expression.
|
||||
| In Vivo Model | Breast cancer PDX model (PDX: MAXF 1322) | ||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [9] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.1 nM
|
Positive CD138 expression (CD138+++/++) | ||
| Method Description |
WT nBT062-DM4, stable nBT062-DM4, half nBT062-DM4 or bispecific nBT062-natalizumab-DM4 were added to the cells. Cells were incubated and after 5 days the viability was determined using the WST-1 cell proliferation assay.
|
||||
| In Vitro Model | Plasma cell myeloma | NCI-H929 cells | CVCL_1600 | ||
BT062-SPDB-DM4 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [10] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 56.56% | |||
| Method Description |
The inhibitory activity of nBT062-SPDB-DM4 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 100g/kg.
|
||||
| In Vivo Model | SCID-hu MM model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [10] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 87.92% | |||
| Method Description |
The inhibitory activity of nBT062-SPDB-DM4 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 250g/kg.
|
||||
| In Vivo Model | SCID-hu MM model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [10] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95% | |||
| Method Description |
The inhibitory activity of nBT062-SPDB-DM4 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with 450g/kg.
|
||||
| In Vivo Model | SCID-hu MM model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
NBT062-SPP-DM1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 77.61% | Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg.
|
||||
| In Vivo Model | MOLP-8 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 84.27% | Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg.
|
||||
| In Vivo Model | MOLP-8 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 92.11% | Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 450 ug/kg.
|
||||
| In Vivo Model | MOLP-8 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
1.00-10.00 nM
|
Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 100 nM | Negative CD138 expression (CD138 -) | ||
| Method Description |
CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
|
||||
| In Vitro Model | Burkitt lymphoma | BJAB cells | CVCL_5711 | ||
NBT062-SMCC-DM1 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 78.02% | Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg.
|
||||
| In Vivo Model | MOLP-8 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 93.32% | Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 250 ug/kg per week (five weeks).
|
||||
| In Vivo Model | MOLP-8 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 94.27% | Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
MOLP-8 cells (1.5x107 cells per mouse) suspended in a 50:50 mixture of serum free media and matrigel were injected subcutaneously in the area under the right shoulder in 100 ul. Nine groups (n=6) were treated with a single intravenous injection of ADCs, each at doses of 450 ug/kg.
|
||||
| In Vivo Model | MOLP-8 CDX model | ||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.1 nM
|
Positive CD138 expression (CD138 +++/++) | ||
| Method Description |
CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-8 cells | CVCL_2124 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [8] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) | > 100 nM | Negative CD138 expression (CD138 -) | ||
| Method Description |
CD138+ MOLP-8 cells were seeded in flat bottom plates at 3000 cells/well. CD138- BJAB control cells were seeded at 1000 cells/weli. The cells were treated with nBT062-SPDB-DM4nBT062-SPP-DM1 or nBT062-SMCC-DM1 at different concentrations for five days.
|
||||
| In Vitro Model | Burkitt lymphoma | BJAB cells | CVCL_5711 | ||
Indatuximab-Compound (Ia) [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [11] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
35.7 pM
|
Positive CD38 expression (CD38+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Plasma cell myeloma | OPM-2 cells | CVCL_1625 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [11] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
52.6 pM
|
Positive CD38 expression (CD38+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.S cells | CVCL_8792 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [11] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
90.6 pM
|
Positive CD38 expression (CD38+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Plasma cell myeloma | MOLP-2 cells | CVCL_2123 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [11] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.12 nM
|
Positive CD38 expression (CD38+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Plasma cell myeloma | MM1.R cells | CVCL_8794 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [11] | ||||
| Efficacy Data | Half Maximal Inhibitory Concentration (IC50) |
0.36 nM
|
Positive CD38 expression (CD38+++/++) | ||
| Method Description |
Cells were plated at about 500 cells per well in a 96-well plate in 100 uL of media. In vitro activity and targeted delivery of ADCs, the isotype-matched negative controls ADCs, and naked antibodies control were assessed in cells.
|
||||
| In Vitro Model | Plasma cell myeloma | KMS-12-BM cells | CVCL_1334 | ||
JP7623413B2 ExampleADC56 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [12] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (IC50) |
1.9 nM
|
Positive CD30 expression (CD30+++/++) | ||
| Method Description |
Karpas-299 cells (ECACC), which are CD30 antigen-positiveand HER2 antigen-negative,were cultured in RPMI 1640 (GIBCO)containing 30%fetal bovine serum (MP Biomedicals) (hereinafter,referred to as "culture medium A" in this test).
|
||||
| In Vitro Model | ALK-positive anaplastic large cell lymphoma | Karpas-299 cells | CVCL_1324 | ||
References
