General Information of This Antibody (ID: ANI0NMRGS)
Antibody Name
MAB802
Synonyms
Fyper-fucosylated Trastuzumab
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Receptor tyrosine-protein kinase erbB-2 (ERBB2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE
MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
The Activity Data of This Antibody
Antibody Activity Information 1 [1]
Dissociation Constant (Kd)
986
pM
Antibody Function Confirm the effect of the drug conjugation with the anti-HER2 Ab on binding activity to target.
Antibody Antigen Binding Assay Binding affinity of MRG002 and MAB802 to human HER2 as determined by SPR.
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Trastuzumab vedotin [Phase 3]
Identified from the Human Clinical Data
Click To Hide/Show 27 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Progression Free Survival
5.5 months
Patients Enrolled
Eligible patients (18-75 years) must have HER2-positive (IHC 3+/2+) metastatic urothelial cancer with ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, and adequate organ function, following ≥1 prior chemotherapy failure. Key exclusions include active infections, CNS metastasis, uncontrolled systemic/autoimmune diseases, recent immunotherapy (≤4 weeks), pregnancy, or investigator-deemed ineligibility. LVEF must be ≥50%, with prior treatment toxicities resolved to ≤Grade 1.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated by an IV infusion of 2.6 mg/kg on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04839510  Clinical Status PHASE2
Clinical Description
An Open-label, Single-arm, Multi-center, Phase II Clinical Study of MRG002 in the Treatment of Patients With HER2-positive Unresectable Locally Advanced or Metastatic Urothelium Cancer
Primary Endpoint
The primary efficacy endpoint is the Objective Response Rate (ORR) assessed by Independent Review Committee (IRC) per RECIST v1.1 criteria, measuring complete and partial responses over 12 months from baseline.
Other Endpoint
Secondary endpoints include investigator-assessed ORR, Duration of Response (DoR), Time to Response (TTR), Disease Control Rate (DCR), Progression-Free Survival (PFS), and Overall Survival (OS), all evaluated over 12 months. Safety assessments involve adverse event monitoring (30 days post-treatment), pharmacokinetic concentration-time analysis, and anti-drug antibody (ADA) incidence among all treated patients.

   Click to Show/Hide
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Objective Response Rate (ORR)
37.5
39.5 %
Patients Enrolled
Inclusion: HER2-low metastatic breast cancer (≥1 prior systemic therapy), ECOG 0-1, measurable disease (RECIST 1.1), LVEF≥50%, adequate organ function. Exclusion: Active CNS metastases, uncontrolled infections (HBV/HCV/HIV), severe cardiac/autoimmune diseases, recent thromboembolism (≤3 months), pregnancy/lactation, or prior grade≥3 hypersensitivity to trastuzumab components.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated via intravenous infusion of 2.6 mg/kg once on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04742153  Clinical Status PHASE2
Clinical Description
A Multicenter, Non-randomized, Open-label Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG002 in the Treatment of Patients With HER2-low Locally Advanced or Metastatic Breast Cancer (BC)
Primary Endpoint
Objective Response Rate (ORR) by Independent Review Committee (IRC) is defined as CR+PR per RECIST v1.1, assessed from baseline to 12 months. Safety data (AEs/SAEs by NCI-CTCAE v5.0), PK analysis (MRG002 concentration-time curve), and immunogenicity (anti-drug antibody incidence) are collected during treatment and follow-up.
Other Endpoint
Efficacy endpoints include ORR by investigator, PFS (baseline to progression/death), 6/12-month PFSR, TTR, DoR, DCR (CR+PR+SD), and OS (baseline to death), all evaluated per RECIST v1.1 over 12 months.
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Objective Response Rate (ORR)
65%
Patients Enrolled
Eligible patients (18-75 years) must have HER2-positive (IHC 3+/2+) metastatic urothelial cancer with ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, and adequate organ function, following ≥1 prior chemotherapy failure. Key exclusions include active infections, CNS metastasis, uncontrolled systemic/autoimmune diseases, recent immunotherapy (≤4 weeks), pregnancy, or investigator-deemed ineligibility. LVEF must be ≥50%, with prior treatment toxicities resolved to ≤Grade 1.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated by an IV infusion of 2.6 mg/kg on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04839510  Clinical Status PHASE2
Clinical Description
An Open-label, Single-arm, Multi-center, Phase II Clinical Study of MRG002 in the Treatment of Patients With HER2-positive Unresectable Locally Advanced or Metastatic Urothelium Cancer
Primary Endpoint
The primary efficacy endpoint is the Objective Response Rate (ORR) assessed by Independent Review Committee (IRC) per RECIST v1.1 criteria, measuring complete and partial responses over 12 months from baseline.
Other Endpoint
Secondary endpoints include investigator-assessed ORR, Duration of Response (DoR), Time to Response (TTR), Disease Control Rate (DCR), Progression-Free Survival (PFS), and Overall Survival (OS), all evaluated over 12 months. Safety assessments involve adverse event monitoring (30 days post-treatment), pharmacokinetic concentration-time analysis, and anti-drug antibody (ADA) incidence among all treated patients.

   Click to Show/Hide
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Disease control rate (DCR)
62.5
76.3 %
Patients Enrolled
Inclusion: HER2-low metastatic breast cancer (≥1 prior systemic therapy), ECOG 0-1, measurable disease (RECIST 1.1), LVEF≥50%, adequate organ function. Exclusion: Active CNS metastases, uncontrolled infections (HBV/HCV/HIV), severe cardiac/autoimmune diseases, recent thromboembolism (≤3 months), pregnancy/lactation, or prior grade≥3 hypersensitivity to trastuzumab components.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated via intravenous infusion of 2.6 mg/kg once on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04742153  Clinical Status PHASE2
Clinical Description
A Multicenter, Non-randomized, Open-label Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG002 in the Treatment of Patients With HER2-low Locally Advanced or Metastatic Breast Cancer (BC)
Primary Endpoint
Objective Response Rate (ORR) by Independent Review Committee (IRC) is defined as CR+PR per RECIST v1.1, assessed from baseline to 12 months. Safety data (AEs/SAEs by NCI-CTCAE v5.0), PK analysis (MRG002 concentration-time curve), and immunogenicity (anti-drug antibody incidence) are collected during treatment and follow-up.
Other Endpoint
Efficacy endpoints include ORR by investigator, PFS (baseline to progression/death), 6/12-month PFSR, TTR, DoR, DCR (CR+PR+SD), and OS (baseline to death), all evaluated per RECIST v1.1 over 12 months.
Experiment 5 Reporting the Activity Date of This ADC [2]
Efficacy Data Disease control rate (DCR)
91%
Patients Enrolled
Eligible patients (18-75 years) must have HER2-positive (IHC 3+/2+) metastatic urothelial cancer with ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, and adequate organ function, following ≥1 prior chemotherapy failure. Key exclusions include active infections, CNS metastasis, uncontrolled systemic/autoimmune diseases, recent immunotherapy (≤4 weeks), pregnancy, or investigator-deemed ineligibility. LVEF must be ≥50%, with prior treatment toxicities resolved to ≤Grade 1.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated by an IV infusion of 2.6 mg/kg on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04839510  Clinical Status PHASE2
Clinical Description
An Open-label, Single-arm, Multi-center, Phase II Clinical Study of MRG002 in the Treatment of Patients With HER2-positive Unresectable Locally Advanced or Metastatic Urothelium Cancer
Primary Endpoint
The primary efficacy endpoint is the Objective Response Rate (ORR) assessed by Independent Review Committee (IRC) per RECIST v1.1 criteria, measuring complete and partial responses over 12 months from baseline.
Other Endpoint
Secondary endpoints include investigator-assessed ORR, Duration of Response (DoR), Time to Response (TTR), Disease Control Rate (DCR), Progression-Free Survival (PFS), and Overall Survival (OS), all evaluated over 12 months. Safety assessments involve adverse event monitoring (30 days post-treatment), pharmacokinetic concentration-time analysis, and anti-drug antibody (ADA) incidence among all treated patients.

   Click to Show/Hide
Experiment 6 Reporting the Activity Date of This ADC [2]
Efficacy Data Complete response (CR)
9%
Patients Enrolled
Eligible patients (18-75 years) must have HER2-positive (IHC 3+/2+) metastatic urothelial cancer with ≥1 measurable lesion (RECIST v1.1), ECOG 0-1, and adequate organ function, following ≥1 prior chemotherapy failure. Key exclusions include active infections, CNS metastasis, uncontrolled systemic/autoimmune diseases, recent immunotherapy (≤4 weeks), pregnancy, or investigator-deemed ineligibility. LVEF must be ≥50%, with prior treatment toxicities resolved to ≤Grade 1.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated by an IV infusion of 2.6 mg/kg on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04839510  Clinical Status PHASE2
Clinical Description
An Open-label, Single-arm, Multi-center, Phase II Clinical Study of MRG002 in the Treatment of Patients With HER2-positive Unresectable Locally Advanced or Metastatic Urothelium Cancer
Primary Endpoint
The primary efficacy endpoint is the Objective Response Rate (ORR) assessed by Independent Review Committee (IRC) per RECIST v1.1 criteria, measuring complete and partial responses over 12 months from baseline.
Other Endpoint
Secondary endpoints include investigator-assessed ORR, Duration of Response (DoR), Time to Response (TTR), Disease Control Rate (DCR), Progression-Free Survival (PFS), and Overall Survival (OS), all evaluated over 12 months. Safety assessments involve adverse event monitoring (30 days post-treatment), pharmacokinetic concentration-time analysis, and anti-drug antibody (ADA) incidence among all treated patients.

   Click to Show/Hide
Experiment 7 Reporting the Activity Date of This ADC [4]
Patients Enrolled
Inclusion: HER2-positive breast cancer (unresectable/metastatic), prior anti-HER2 therapy failure (Phase II: trastuzumab/TKI/ADC-resistant; Phase III: 1-2 prior lines excluding ADCs), measurable disease (RECIST 1.1), ECOG 0-1, adequate organ function. Exclusion: Active CNS metastases, uncontrolled infections (HBV/HCV/HIV), severe cardiac/pulmonary diseases, prior hypersensitivity to trastuzumab components, recent major surgery/radiotherapy (<4 weeks), Child-Pugh B/C cirrhosis, or >Grade 1 neuropathy. Contraception required for reproductive-age participants.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated via intravenous infusion of 2.6 mg/kg once on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04924699  Clinical Status PHASE2|||PHASE3
Clinical Description
A Study of MRG002 in the Treatment of Patients With HER2-positive Unresectable Locally Advanced or Metastatic Breast Cancer
Primary Endpoint
Progression-Free Survival (PFS) as assessed by Independent Review Committee (IRC) is the primary efficacy endpoint, defined as time from treatment initiation to disease progression or death (per RECIST v1.1) over 36 months. Secondary objectives include pharmacokinetic analysis (drug concentration-time curve) and immunogenicity assessment (anti-drug antibody incidence).

   Click to Show/Hide
Other Endpoint
Key secondary endpoints include Objective Response Rate (ORR=CR+PR), Duration of Response (DoR), Disease Control Rate (DCR=CR+PR+SD) per RECIST v1.1, investigator-assessed PFS, Overall Survival (OS), and safety monitoring (AEs tracked until 30 days post-treatment). All efficacy measures are evaluated over a 36-month period.
Experiment 8 Reporting the Activity Date of This ADC [5]
Patients Enrolled
Inclusion criteria: HER2-positive breast cancer patients (18-75 years) with liver metastasis (confirmed by central lab), measurable lesions (RECIST v1.1), ECOG 0-1, life expectancy &ge;12 weeks, and adequate organ function. Exclusion criteria: Prior ADC treatment, CNS metastasis, severe neuropathy (&ge;Grade 2), uncontrolled infections/systemic diseases (e.g., cardiac, hepatic cirrhosis with single metastasis &ge;10 cm), active autoimmune disease requiring immunosuppressants, or prior hypersensitivity to trastuzumab components. Effective contraception is mandatory for participants of childbearing potential.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated via intravenous infusion of 2.6 mg/kg once on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT05263869  Clinical Status PHASE2
Clinical Description
An Open-label, Multi-center, Single-arm Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG002 in Advanced HER-2 Positive Breast Cancer Patients Previously Treated With Trastuzumab and TKIs (Magic-009)
Primary Endpoint
The primary endpoint is Objective Response Rate (ORR) by Independent Review Committee (IRC), defined as the proportion of patients achieving complete response (CR) or partial response (PR) per RECIST v1.1 criteria, evaluated over 12 months from baseline.
Other Endpoint
Secondary efficacy endpoints include investigator-assessed ORR, Duration of Response (DoR), Clinical Benefit Rate (CBR=CR+PR+SD≥6 months), Time to Response (TTR), Disease Control Rate (DCR=CR+PR+SD), Progression-Free Survival (PFS), and Overall Survival (OS). Safety assessments (AEs) and pharmacokinetics (drug concentration-time curve) are monitored during treatment and post-treatment follow-up, with immunogenicity analyzed via anti-drug antibody (ADA) incidence.

   Click to Show/Hide
Experiment 9 Reporting the Activity Date of This ADC [6]
Patients Enrolled
Inclusion criteria: HER2-positive (IHC 2+/3+) carcinoma of unknown primary origin (squamous/adenocarcinoma) patients (&ge;18 years) with &ge;1 prior systemic therapy line, measurable disease (RECIST 1.1), ECOG 0-1, LVEF&ge;50%, and adequate organ function. Exclusion criteria: Active/uncontrolled metastases (CNS/third-space effusions), severe cardiac/infectious diseases (HBV/HCV/HIV), autoimmune disorders requiring immunosuppressants, allergy to MRG002 components, pregnancy/lactation, or other investigator-assessed ineligibility. Contraception is mandatory during and 6 months post-treatment.

   Click to Show/Hide
Administration Dosage
Pucotenlimab 200mg iv d1, Q3W MRG002 2.2mg/kg d1, Q3W
Related Clinical Trial
NCT Number NCT06869174  Clinical Status PHASE2
Clinical Description
A Phase II Clinical Trial to Evaluate the Efficacy and Safety of Pucotenlimab in Combination with MRG002 in Treating HER2-positive Cancer of Unknown Primary
Primary Endpoint
The primary endpoint is overall response rate (ORR), defined as the percentage of participants achieving complete response (CR) or partial response (PR) per RECIST 1.1 criteria, as assessed by investigators, with evaluation spanning from enrollment until first documented response (up to 12 months).
Experiment 10 Reporting the Activity Date of This ADC [7]
Patients Enrolled
Inclusion criteria: HER2-positive (IHC 3+ or 2+) biliary tract cancer patients (18-75 years) with unresectable/metastatic disease, &ge;1 prior therapy failure, measurable lesions (RECIST v1.1), ECOG 0-1, LVEF&ge;50%, and adequate organ function. Exclusion criteria: Severe allergies to MRG002 components, active infections (HBV/HCV/HIV), CNS metastasis, uncontrolled effusions requiring drainage, autoimmune diseases, decompensated cirrhosis, or pregnancy/lactation. Contraception is mandatory during and 6 months post-treatment.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated by an IV infusion of 2.6 mg/kg on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04837508  Clinical Status PHASE2
Clinical Description
An Open-label, Single-arm, Multi-center, Phase II Clinical Study of MRG002 in the Treatment of Patients With HER2-positive Unresectable, Locally Advanced or Metastatic Biliary Tract Cancer
Primary Endpoint
The primary endpoint is objective response rate (ORR) assessed by Independent Review Committee (IRC), defined as the percentage of patients achieving complete response (CR) or partial response (PR) based on RECIST v1.1 criteria, evaluated from baseline until study completion (up to 12 months).
Other Endpoint
Secondary endpoints include investigator-assessed ORR, duration of response (DOR), time to response (TTR), disease control rate (DCR), progression-free survival (PFS), and overall survival (OS). Safety is monitored via adverse events (AEs) up to 30 days post-treatment. Pharmacokinetic (PK) parameters, including concentration-time curve, and immunogenicity (anti-drug antibody, ADA) incidence are analyzed.

   Click to Show/Hide
Experiment 11 Reporting the Activity Date of This ADC [8]
Patients Enrolled
Inclusion criteria: HER2-positive (IHC 3+ or IHC 2+/ISH+) or low HER2 (IHC 1+ or IHC 2+/ISH-) gastric/GEJ cancer patients (&ge;18 years) with progression after platinum/fluoropyrimidine &plusmn; anti-HER2 therapy, measurable disease (RECIST v1.1), ECOG 0-1, and adequate organ function. Exclusion criteria: Prior HER2-ADC exposure, untreated CNS metastases, severe cardiac/pulmonary disease, active infections (HBV/HCV/HIV/syphilis), recent major surgery, or uncontrolled comorbidities. Contraception is required during and 180 days post-treatment.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated by an IV infusion of 2.6 mg/kg on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT05141747  Clinical Status PHASE2
Clinical Description
An Open-label, Multi-center, Phase II Clinical Study to Evaluate the Safety, Efficacy and Pharmacokinetics of MRG002 in Patients With HER2-positive/HER2-low Locally Advanced or Metastatic Gastric/ Gastroesophageal Junction Cancer.
Primary Endpoint
The primary endpoints are objective response rate (ORR) per RECIST v1.1 and adverse events (AEs). ORR is defined as the percentage of patients achieving complete or partial response, evaluated over 24 months, while AEs are monitored for 45 days post-treatment.
Other Endpoint
Secondary endpoints include progression-free survival (PFS), overall survival (OS), duration of response (DOR), and disease control rate (DCR), all assessed over 24 months. Pharmacokinetic (PK) analysis tracks drug concentration over time, and immunogenicity measures anti-drug antibody (ADA) incidence up to 30 days post-treatment.
Experiment 12 Reporting the Activity Date of This ADC [9]
Patients Enrolled
Inclusion criteria: HER2-positive metastatic/unresectable cancer patients (&ge;18 years) with prior standard therapy failure, measurable disease (RECIST v1.1), ECOG 0-1, adequate organ function, and available tumor tissue. Exclusion criteria: Unresolved Grade >1 toxicities from prior treatments, untreated CNS metastases, recent major surgery, severe cardiac/pulmonary conditions, active infections (HBV/HCV/HIV), uncontrolled comorbidities, or hypersensitivity to MRG002 components. Pregnancy and strong CYP3A4 inhibitor use are prohibited.

   Click to Show/Hide
Administration Dosage
Phase I Dose Escalation: MRG002 will be administrated by an IV infusion of escalating doses (starting dose of 2.2 mg/kg, followed by 2.6 mg/kg) on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04492488  Clinical Status PHASE1|||PHASE2
Clinical Description
An Open-Label, Multi-center Phase I/II Dose Escalation and Expansion Study to Assess the Safety, Efficacy and Pharmacokinetics of MRG002 in Patients with HER2-Positive Advanced Solid Tumors and Locally Advanced or Metastatic Gastric/Gastroesophageal Junction (GEJ) Cancer
Primary Endpoint
The primary objectives include determining the Maximum Tolerated Dose (MTD) by assessing dose-limiting toxicities (DLT) during the first 21-day cycle and establishing the Recommended Phase II Dose (RP2D) for MRG002. Key efficacy measures include Objective Response Rate (ORR) assessed by Independent Central Review (ICR) per RECIST v1.1 over 24 months, alongside comprehensive safety evaluations of adverse events (AEs) coded via MedDRA until 45 days post-treatment.

   Click to Show/Hide
Other Endpoint
Secondary efficacy endpoints (Duration of Response [DoR], Disease Control Rate [DCR], Progression-Free Survival [PFS]) will undergo sensitivity analyses based on investigator assessments. Pharmacokinetic (PK) parameters (Cmax, AUClast) for MRG002, total antibody (TAb), and Monomethyl Auristatin E (MMAE) will be derived from serial blood samples, with immunogenicity monitored via anti-drug antibody (ADA) incidence throughout the study.

   Click to Show/Hide
Experiment 13 Reporting the Activity Date of This ADC [10]
Patients Enrolled
The study excludes patients with small-cell/mixed lung cancer, uncontrolled comorbidities (hypertension, bleeding disorders), autoimmune/active infections, or live vaccinations within 30 days. Other disqualifiers include interstitial lung disease, pleural effusions requiring frequent drainage, or conditions compromising safety/study integrity per investigator judgment. Strict contraception (120 days post-treatment) and avoidance of immunotherapies/systemic steroids are mandated.

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated via intravenous infusion of 2.6 mg/kg once on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT05141786  Clinical Status PHASE2
Clinical Description
An Open-label, Multi-center, Non-randomized Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG002 in Patients With HER2-mutated Unresectable/Metastatic Non-small Cell Lung Cancer (NSCLC).
Primary Endpoint
ORR assessed by Independent Review Committee (IRC) is the primary efficacy endpoint, defined as the proportion of subjects achieving CR or PR per RECIST v1.1 over 12 months. Secondary assessments include investigator-evaluated ORR, DCR (CR+PR+SD), DOR, PFS, and OS, all measured over 12 months. Safety monitoring tracks AEs until 45 days post-treatment, while PK analysis evaluates drug concentration-time curves and immunogenicity (ADA incidence) up to 30 days post-treatment.

   Click to Show/Hide
Other Endpoint
NSCLC patients with HER2 mutations (aged 18-75, life expectancy ≥3 months) who failed prior SOC therapy are eligible if they have measurable disease (RECIST v1.1), ECOG 0-1, and adequate organ function. Key exclusions: prior HER2-ADC/antibody treatment, active CNS metastases, uncontrolled infections (HBV/HCV/HIV), severe cardiac/pulmonary conditions, recent major surgery/immunotherapy, or concurrent strong CYP3A4 modifiers. Pregnancy and inadequate contraception are prohibited.

   Click to Show/Hide
Experiment 14 Reporting the Activity Date of This ADC [11]
Patients Enrolled
Eligibility requires HER2-positive solid tumor patients (18-75 years, ECOG 0-1) with progressed/refractory disease, &ge;1 measurable lesion (RECIST 1.1), and adequate organ function. Exclusions: recent antitumor therapy (&le;3 weeks), uncontrolled comorbidities (cardiac/pulmonary/GI), active infections (HBV/HCV/HIV), major surgery (&le;4 months), or corticosteroid use (&le;4 weeks). Pregnancy, inadequate contraception, or investigator-deemed ineligibility also preclude participation.

   Click to Show/Hide
Administration Dosage
All patients in Phase Ia (dose escalation) and Phase Ib (dose expansion) will be administrated MRG002 on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT04941339  Clinical Status PHASE1
Clinical Description
A Phase I, Open-label, Multi-center, First in Human, Dose Escalation and Expansion Study to Assess the Safety, Tolerability, Efficacy and Pharmacokinetics of MRG002 in Patients With HER2 Positive Advanced Solid Tumors
Primary Endpoint
The study aims to determine the Maximum Tolerated Dose (MTD) of MRG002, defined as the highest dose where ≤1/6 patients experience dose-limiting toxicities (DLT) during the first 28-day cycle. The Recommended Phase II Dose (RP2D) will be established based on comprehensive safety, efficacy, and PK assessments over 6 months. Adverse events (AEs) will be monitored from baseline through 49 days post-treatment, capturing all treatment-related reactions.

   Click to Show/Hide
Other Endpoint
Key efficacy measures include Objective Response Rate (ORR) per RECIST v1.1, Duration of Response (DoR), and Progression-Free Survival (PFS), all evaluated over 6 months. Pharmacokinetic parameters (Cmax, Tmax, t1/2, AUClast) will be analyzed from baseline to 21 days post-treatment, alongside immunogenicity assessments (ADA positivity rate).
Experiment 15 Reporting the Activity Date of This ADC [12]
Patients Enrolled
Eligible patients (18-75 years) must have HER2-positive advanced solid tumors with measurable lesions (RECIST v1.1), ECOG 0-1, and adequate organ function. Key exclusions include prior ADC/immunotherapy (&le;60 days), steroid use (&le;14 days), active infections, CNS metastases, significant cardiorespiratory disease, or pregnancy. Anthracycline exposure is capped at &le;450 mg/m2 doxorubicin equivalent. Investigators may exclude patients deemed unsuitable for study participation.

   Click to Show/Hide
Administration Dosage
Experimental: MRG002+HX008, MRG002 will be administrated via intravenous infusion at 1.8,,2.2, or 2.6 mg/kg , (if appropriate) once on Day 1 of every 3 weeks (21-day cycle), up to 24 months.HX008 will be administrated via intravenous infusion at 3 mg/kg once on Day 1 of every 3 weeks (21-day- cycle), up to 24 months.
Related Clinical Trial
NCT Number NCT05338957  Clinical Status PHASE1|||PHASE2
Clinical Description
An Open-label, Multi-center, Phase I/II Dose Escalation and Expansion Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Preliminary Efficacy of MRG002 in Combination With HX008 in Patients With HER2-expressed Advanced Malignant Solid Tumors.
Primary Endpoint
The study will evaluate dose-limiting toxicities (DLTs) occurring within 28 days post-first dose to establish the safety profile of MRG002. Adverse events will be monitored from consent until 90 days after treatment completion, with all potential drug-related reactions recorded. The Recommended Phase II Dose (RP2D) will be determined based on 24-month safety, efficacy, and pharmacokinetic data.

   Click to Show/Hide
Other Endpoint
Efficacy outcomes include Objective Response Rate (ORR), Duration of Response (DOR), Disease Control Rate (DCR), Progression-Free Survival (PFS), Time to Response (TTR), and Overall Survival (OS), all measured over 24 months. Pharmacokinetic profiling will examine concentration-time curves, while immunogenicity will assess anti-drug antibody (ADA) incidence - both monitored up to 90 days post-treatment.

   Click to Show/Hide
Experiment 16 Reporting the Activity Date of This ADC [13]
Patients Enrolled
Eligible patients (18-75 years) must have platinum/PD- (L)1-refractory, HER2-positive (IHC 3+/2+) metastatic urothelial carcinoma with measurable lesions (RECIST v1.1), ECOG 0-1, and adequate organ function. Exclusions involve prior ADC/taxane therapy (&le;4 weeks), uncontrolled effusions/CNS metastasis, active infections, severe comorbidities, autoimmune diseases requiring immunosuppression, or investigator-deemed risks. Prior treatment toxicities must resolve to &le;Grade 1 (excluding alopecia/asymptomatic lab abnormalities).

   Click to Show/Hide
Administration Dosage
MRG002 will be administrated by an IV infusion of 2.2 mg/kg on Day 1 of every 3 weeks (21-day cycle).
Related Clinical Trial
NCT Number NCT05754853  Clinical Status PHASE3
Clinical Description
An Open-label, Randomized, Multi-center, Phase III Clinical Study of MRG002 Versus Investigator's Choice of Chemotherapy in the Treatment of Patients With HER2-positive Unresectable Locally Advanced or Metastatic Urothelial Cancer Previously Treated With Platinum-based Chemotherapy and PD-1/PD-L1 Inhibitors
Primary Endpoint
The primary endpoints include Overall Survival (OS) and Independent Review Committee-assessed Progression-Free Survival (PFS), both measured from randomization to death or progression over 36 months.
Other Endpoint
Secondary efficacy measures comprise ORR, DoR, DCR, CBR (responses lasting ≥6 months), and investigator-assessed PFS, along with TTR-all evaluated for 36 months. Safety assessments track AEs (30 days post-treatment), PK concentration-time curves (7 days post-discontinuation), and immunogenicity (ADA/NAb incidence and titers).
Experiment 17 Reporting the Activity Date of This ADC [14]
Efficacy Data Objective Response Rate (ORR)
34.70%
Patients Enrolled
Advanced/metastatic HER2-low expressing breast cancer that failed standard therapies.
Administration Dosage
MRG002 was administered intravenously once every 3 weeks at the dose of 2.60 mg/kg, until disease progression or unacceptable toxicity which ever occurred first.
Related Clinical Trial
NCT Number NCT04742153  Clinical Status Phase 2
Clinical Description
A multicenter, non-randomized, open-label phase 2 clinical study to evaluate the efficacy and safety of MRG002 in the treatment of patients with HER2-low locally advanced or metastatic breast cancer (BC).
Experiment 18 Reporting the Activity Date of This ADC [15]
Efficacy Data Objective Response Rate (ORR)
65%
Patients Enrolled
Histologically HER2-positive (IHC 2+ or 3+) UC pts confirmed by a central-laboratory, ECOG PS 0-1, prior received 1 standard treatment.
Administration Dosage
Receive MRG002 at a dose of 2.60 mg/kg or 2.20 mg/kg administered by intravenous infusion every 3 weeks.
Related Clinical Trial
NCT Number NCT04839510  Clinical Status Phase 2
Clinical Description
An open-label, single-arm, multi-center, phase 2 clinical study of MRG002 in the treatment of patients with HER2-positive unresectable locally advanced or metastatic urothelium cancer.
Experiment 19 Reporting the Activity Date of This ADC [16]
Related Clinical Trial
NCT Number NCT05754853  Clinical Status Phase 3
Clinical Description
An open-label, randomized, multi-center, phase 3 clinical study of MRG002 versus investigator's choice of chemotherapy in the treatment of patients with HER2-positive unresectable locally advanced or metastatic urothelial cancer previously treated with platinum-based chemotherapy and PD-1/PD-L1 inhibitors.
Experiment 20 Reporting the Activity Date of This ADC [17]
Related Clinical Trial
NCT Number NCT04924699  Clinical Status Phase 2/3
Clinical Description
A study of MRG002 in the treatment of patients with HER2-positive unresectable locally advanced or metastatic breast cancer.
Experiment 21 Reporting the Activity Date of This ADC [18]
Related Clinical Trial
NCT Number NCT05141786  Clinical Status Phase 2
Clinical Description
An open-label, multi-center, non-randomized phase 2 clinical study to evaluate the efficacy and safety of MRG002 in patients With HER2-mutated unresectable/metastatic non-small cell lung cancer (NSCLC).
Experiment 22 Reporting the Activity Date of This ADC [19]
Related Clinical Trial
NCT Number NCT04837508  Clinical Status Phase 2
Clinical Description
An open-label, single-arm, multi-center, phase 2 clinical study of MRG002 in the treatment of patients with HER2-positive unresectable, locally advanced or metastatic biliary tract cancer.
Experiment 23 Reporting the Activity Date of This ADC [20]
Related Clinical Trial
NCT Number NCT05141747  Clinical Status Phase 2
Clinical Description
An open-label, multi-center, phase 2 clinical study to evaluate the safety, efficacy and pharmacokinetics of MRG002 in patients with HER2-positive/HER2-low locally advanced or metastatic gastric/ gastroesophageal junction cancer.
Experiment 24 Reporting the Activity Date of This ADC [21]
Related Clinical Trial
NCT Number NCT05263869  Clinical Status Phase 2
Clinical Description
An open-label, multi-center, single-arm phase 2 clinical study to evaluate the efficacy and safety of MRG002 in advanced HER-2 positive breast cancer patients previously treated with trastuzumab and TKIs (Magic-009).
Experiment 25 Reporting the Activity Date of This ADC [22]
Related Clinical Trial
NCT Number NCT04492488  Clinical Status Phase 1/2
Clinical Description
An open-label, multi-center phase 1/2 dose escalation and expansion study to assess the safety, efficacy and pharmacokinetics of MRG002 in patients with HER2-positive advanced solid tumors and locally advanced or metastatic gastric/gastroesophageal junction (GEJ) cancer.
Experiment 26 Reporting the Activity Date of This ADC [23]
Related Clinical Trial
NCT Number NCT05338957  Clinical Status Phase 1/2
Clinical Description
An open-label, multi-center, phase 1/2 dose escalation and expansion study to evaluate the safety, tolerability, pharmacokinetics and preliminary efficacy of MRG002 in combination with HX008 in patients with HER2-expressed advanced malignant solid tumors.
Experiment 27 Reporting the Activity Date of This ADC [24]
Related Clinical Trial
NCT Number NCT04941339  Clinical Status Phase 1
Clinical Description
A phase 1, open-label, multi-center, first in human, dose escalation and expansion study to assess the safety, tolerability, efficacy and pharmacokinetics of MRG002 in patients with HER2 positive advanced solid tumors.
Discovered Using Patient-derived Xenograft Model
Click To Hide/Show 16 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
0%
Moderate HER2 expression (HER2++; IHC 2+)
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#151)
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
10%
Low HER2 expression (HER2+; IHC 1+)
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#395)
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
17%
High HER2 expression (HER2+++; IHC 3+)
In Vivo Model HER2-positive breast cancer PDX model (PDX: BC#239)
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
19%
Moderate HER2 expression (HER2++; IHC 2+)
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#053)
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
41%
Moderate HER2 expression (HER2++; IHC 2+)
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#240)
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 55.10% High HER2 expression (HER2+++; IHC 3+)
In Vivo Model HER2-positive breast cancer PDX model (PDX: BC#046)
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 70% Moderate HER2 expression (HER2++; IHC 2+)
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#179)
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 70.40% High HER2 expression (HER2+++; IHC 3+)
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#410)
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 78.90%
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#410)
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
84%
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#410)
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 87.90%
In Vivo Model HER2-positive breast cancer PDX model (PDX: BC#197)
Experiment 12 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI)
90%
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#069)
Experiment 13 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 94%
In Vivo Model HER2-positive breast cancer PDX model (PDX: BC#046)
Experiment 14 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.10%
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#179)
Experiment 15 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% Low HER2 expression (HER2+; IHC 1+)
In Vivo Model HER2-positive gastric cancer PDX model (PDX: STO#410)
Experiment 16 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 100% High HER2 expression (HER2+++; IHC 3+)
In Vivo Model HER2-positive breast cancer PDX model (PDX: BC#197)
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 6 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 60.70% Moderate HER2 expression (HER2++)
In Vivo Model HER2-positive gastric cancer NCI-N87 CDX model
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 66.20% High HER2 expression (HER2+++)
Method Description
MRG-002 induces efficient tumor cell killing in PDX models of breast cancer or gastric cancer tissues with HER2 expression,administered with vehicle,MRG002,HX008 or MRG002 + HX008 combo intravenously.
In Vivo Model HER2-positive breast cancer BT-474 CDX model
In Vitro Model Invasive breast carcinoma BT-474 cells CVCL_0179
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90% High HER2 expression (HER2+++)
In Vivo Model HER2-positive gastric cancer NCI-N87 CDX model
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90% High HER2 expression (HER2+++)
In Vivo Model HER2-positive gastric cancer NCI-N87 CDX model
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90% Moderate HER2 expression (HER2++; IHC 2+)
In Vivo Model HER2-positive breast cancer BT-474 CDX model
In Vitro Model Invasive breast carcinoma BT-474 cells CVCL_0179
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90% Moderate HER2 expression (HER2++; IHC 2+)
In Vivo Model HER2-positive breast cancer BT-474 CDX model
In Vitro Model Invasive breast carcinoma BT-474 cells CVCL_0179
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.01 nM
Method Description
The inhibitory activity of MRG-002 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with MRG-002 for 96±2 hrs.
In Vitro Model Breast adenocarcinoma SK-BR-3 cells CVCL_0033
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.04 nM
Method Description
The inhibitory activity of MRG-002 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with MRG-002 for 96±2 hrs.
In Vitro Model Invasive breast carcinoma BT-474 cells CVCL_0179
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.15 nM
Method Description
The inhibitory activity of MRG-002 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with MRG-002 for 96±2 hrs.
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.4 nM
Method Description
The inhibitory activity of MRG-002 against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated with MRG-002 for 96±2 hrs.
In Vitro Model Breast adenocarcinoma MDA-MB-453 cells CVCL_0418
References
Ref 1 Preclinical evaluation of MRG002, a novel HER2-targeting antibody-drug conjugate with potent antitumor activity against HER2-positive solid tumors. Antib Ther. 2021 Aug 28;4(3):175-184.
Ref 2 A Study of MRG002 in the Treatment of HER2-positive Unresectable Locally Advanced or Metastatic Urothelium Cancer
Ref 3 A Study of MRG002 in the Treatment of Patients With HER2-low Locally Advanced or Metastatic Breast Cancer (BC)
Ref 4 A Study of MRG002 in the Treatment of Patients With HER2-positive Unresectable Locally Advanced or Metastatic Breast Cancer
Ref 5 A Study of MRG002 in Treatment of Advanced HER-2 Positive Breast Cancer Patients
Ref 6 Pucotenlimab Combined with MRG002 for HER2-positive Cancer of Unknown Primary
Ref 7 A Study of MRG002 in the Treatment of HER2-positive Unresectable, Locally Advanced or Metastatic Biliary Tract Cancer
Ref 8 A Study of MRG002 in the Treatment of HER2-positive/HER2-low Locally Advanced or Metastatic Gastric/Gastroesophageal Junction Cancer.
Ref 9 A Study of MRG002 in Patients with HER2-Positive Advanced Solid Tumors and Locally Advanced or Metastatic Gastric/Gastroesophageal Junction (GEJ) Cancer
Ref 10 A Study of MRG002 in the Treatment of Patients With HER2-mutated Unresectable/Metastatic Non-small Cell Lung Cancer (NSCLC).
Ref 11 A Study of MRG002 in the Treatment of Patients With HER2-positive Advanced Solid Tumors
Ref 12 A Study of MRG002 in the Treatment of Patients With HER2-expressed Advanced Malignant Solid Tumors.
Ref 13 A Study of MRG002 Versus Investigator's Choice of Chemotherapy in the Treatment of Patients With HER2-positive Unresectable Advanced or Metastatic Urothelial Cancer
Ref 14 A multiple center, open-label, single-arm, phase II clinical trial of MRG002, an HER2-targeted antibody-drug conjugate, in patients with HER2-low expressing advanced or metastatic breast cancer. J Clin Oncol. 2022 40:16_suppl, 1102-1102.
Ref 15 MRG002-006: A multicenter phase II clinical trial of MRG002-ADC for unresectable locally advanced or metastatic urothelial cancer. J Clin Oncol. 2022 40:16_suppl, 4570-4570.
Ref 16 An Open-label, Randomized, Multi-center, Phase III Clinical Study of MRG002 Versus Investigator's Choice of Chemotherapy in the Treatment of Patients With HER2-positive Unresectable Locally Advanced or Metastatic Urothelial Cancer Previously Treated With Platinum-based Chemotherapy and PD-1/PD-L1 Inhibitors, NCT05754853
Ref 17 A Study of MRG002 in the Treatment of Patients With HER2-positive Unresectable Locally Advanced or Metastatic Breast Cancer, NCT04924699
Ref 18 An Open-label, Multi-center, Non-randomized Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG002 in Patients With HER2-mutated Unresectable/Metastatic Non-small Cell Lung Cancer (NSCLC). NCT05141786
Ref 19 An Open-label, Single-arm, Multi-center, Phase II Clinical Study of MRG002 in the Treatment of Patients With HER2-positive Unresectable, Locally Advanced or Metastatic Biliary Tract Cancer, NCT04837508
Ref 20 An Open-label, Multi-center, Phase II Clinical Study to Evaluate the Safety, Efficacy and Pharmacokinetics of MRG002 in Patients With HER2-positive/HER2-low Locally Advanced or Metastatic Gastric/ Gastroesophageal Junction Cancer. NCT05141747
Ref 21 An Open-label, Multi-center, Single-arm Phase II Clinical Study to Evaluate the Efficacy and Safety of MRG002 in Advanced HER-2 Positive Breast Cancer Patients Previously Treated With Trastuzumab and TKIs (Magic-009), NCT05263869
Ref 22 An Open-Label, Multi-center Phase I/II Dose Escalation and Expansion Study to Assess the Safety, Efficacy and Pharmacokinetics of MRG002 in Patients With HER2-Positive Advanced Solid Tumors and Locally Advanced or Metastatic Gastric/Gastroesophageal Junction (GEJ) Cancer, NCT04492488
Ref 23 An Open-label, Multi-center, Phase I/II Dose Escalation and Expansion Study to Evaluate the Safety, Tolerability, Pharmacokinetics and Preliminary Efficacy of MRG002 in Combination With HX008 in Patients With HER2-expressed Advanced Malignant Solid Tumors. NCT05338957
Ref 24 A Phase I, Open-label, Multi-center, First in Human, Dose Escalation and Expansion Study to Assess the Safety, Tolerability, Efficacy and Pharmacokinetics of MRG002 in Patients With HER2 Positive Advanced Solid Tumors, NCT04941339