Antibody Information
General Information of This Antibody
| Antibody ID | ANI0JSXOC |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Ladiratuzumab |
|||||
| Organization | Seagen Inc. |
|||||
| Indication | Esophageal squamous cell carcinoma; Melanoma; Prostatic cancer; Small cell lung cancer; |
|||||
| Synonyms |
Anti-LIV1 mAb hLIV22
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Zinc transporter ZIP6 (SLC39A6) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGASVKVSCKASGLTIEDYYMHWVRQAPGQGLEWMGWIDPENGDTEY
GPKFQGRVTMTRDTSINTAYMELSRLRSDDTAVYYCAVHNAHYGTWFAYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG Click to Show/Hide
|
|||||
| Light Chain Sequence |
DVVMTQSPLSLPVTLGQPASISCRSSQSLLHSSGNTYLEWYQQRPGQSPRPLIYKISTRF
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPYTFGGGTKVEIKRTVAAPSV FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Ladiratuzumab vedotin [Phase 2 (discontinued)]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
35%
|
|||
| Patients Enrolled |
Unresectable locally advanced or metastatic triple-negative breast cancer (mTNBC). Patients must have measureable disease per RECIST v1.1, an ECOG score of 0 or 1, and no prior cytotoxic or anti-PD-L1 treatment for advanced disease.
|
||||
| Administration Dosage |
LV 2.50 mg/kg + pembrolizumab 200 mg intravenously every three weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03310957 | Clinical Status | Phase 1/2 | ||
| Clinical Description |
Single arm, open label phase 1b/2 study of SGN-LIV1A in combination with pembrolizumab for first-line treatment of patients with unresectable locally-advanced or metastatic triple-negative breast cancer.
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
32%
|
|||
| Patients Enrolled |
Women with LIV-1-positive, unresectable, locally advanced or metastatic breast cancer (LA/MBC).
|
||||
| Administration Dosage |
Received a median of 3 cycles (range, 112) of SGN-LIV1A at doses of 0.50-2.80 mg/kg.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT01969643 | Clinical Status | Phase 1 | ||
| Clinical Description |
A phase 1, open-label, dose-escalation study to evaluate the safety and tolerability of SGN-LIV1A in patients with metastatic breast cancer.
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Related Clinical Trial | |||||
| NCT Number | NCT04032704 | Clinical Status | Phase 2 | ||
| Clinical Description |
Open-label phase 2 study of ladiratuzumab vedotin (LV) for unresectable locally advanced or metastatic solid tumors.
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [5] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
28%
|
|||
| Patients Enrolled |
Eligible patients require pathologically confirmed, incurable LA/MBC (subtype-specific criteria for Parts A-F), measurable disease, ECOG 0-1, and adequate organ function; exclusions encompass severe neuropathy (≥Grade 2), untreated CNS metastases, prior LV/MMAE therapy, and trastuzumab hypersensitivity (combination arm). Tumor PD-L1/CPS and LIV-1 expression are mandated for specific cohorts.
Click to Show/Hide
|
||||
| Administration Dosage |
SGNLVA-001 (NCT01969643) is an ongoing, multi-part, open label study investigating the safety and efficacy of LV in patients with metastatic breast cancer (mBC). Part E evaluated LV q1w in escalation and expansion starting at LV 1.0 mg/kg q1w. Patients with first (1L) or second line (2L) endocrine therapy refractory hormone receptor-positive (HR+)/HER2-negative (HER2-) mBC or 2L mTNBC were enrolled. Tumor assessments occurred every 6 weeks per RECIST v1.1.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT01969643 | Clinical Status | PHASE1 | ||
| Clinical Description |
A Phase 1, Open-Label, Dose-Escalation Study to Evaluate the Safety and Tolerability of SGN-LIV1A in Patients With Metastatic Breast Cancer
|
||||
| Primary Endpoint |
Safety assessments include monitoring adverse events (AEs), laboratory abnormalities, and dose-limiting toxicities (DLTs) throughout treatment and up to 1 month post-treatment (approx. 2 years) using descriptive statistics to evaluate tolerability.
|
||||
| Other Endpoint |
Pharmacodynamic measures (blood concentrations of LV/metabolites, anti-drug antibodies) and efficacy endpoints (ORR per RECIST v1.1, DOR, PFS, OS, PFS ratio to prior therapy) will be tracked for up to 3-8 years to assess pharmacokinetics, immunogenicity, and clinical response durability.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [6] | ||||
| Patients Enrolled |
Eligible patients must have untreated metastatic/locally-advanced TNBC (PD-L1 CPS<10 for Part D), measurable lesions (≥10mm tumor/≥15mm lymph node), ECOG 0-1, and adequate organ function. Key exclusions: prior immuno-oncology therapy, Grade≥2 neuropathy, active CNS metastases (unless treated/stable for ≥4 weeks without steroids), recent radiotherapy (<2 weeks), active autoimmune disease/interstitial lung disease, or steroid-requiring pneumonitis.
Click to Show/Hide
|
||||
| Administration Dosage |
Patients will receive LV at 1.5 mg/kg on Days 1 and 8 plus pembrolizumab 200 mg on Day 1 Q3W.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03310957 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
Single Arm, Open Label Phase 1b/2 Study of SGN-LIV1A in Combination With Pembrolizumab for First-Line Treatment of Patients With Unresectable Locally-Advanced or Metastatic Triple-Negative Breast Cancer
|
||||
| Primary Endpoint |
The primary efficacy and safety assessments include confirmed objective response rate (ORR) per RECIST v1.1 evaluated up to 18 weeks post-treatment (~1 year), alongside monitoring of adverse events, laboratory abnormalities, and dose-limiting toxicities throughout treatment and up to 1 month post-treatment (~10 months).
|
||||
| Other Endpoint |
Secondary endpoints assessing long-term clinical outcomes include duration of response (DOR), disease control rate (DCR), progression-free survival (PFS), and overall survival (OS), all evaluated per RECIST v1.1 and tracked for up to 2.5 years post-treatment to determine therapeutic durability and survival benefits.
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [7] | ||||
| Patients Enrolled |
Eligible patients must have metastatic/inoperable locally advanced breast cancer (RECIST v1.1 measurable disease), ECOG 0-1, life expectancy ≥3 months, and adequate organ function. Key exclusions: prior immune checkpoint therapies (anti-PD-1/PD-L1/CTLA-4), active/uncontrolled CNS metastases, autoimmune/immunodeficiency disorders, severe infections, significant cardiovascular disease, recent immunosuppressants, or pregnancy/breastfeeding. Tumor biopsy/biomarker testing is mandatory.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT03424005 | Clinical Status | PHASE1|||PHASE2 | ||
| Clinical Description |
A Phase Ib/II, Open-Label, Multicenter, Randomized Umbrella Study Evaluating The Efficacy And Safety Of Multiple Treatment Combinations In Patients With Metastatic Breast Cancer (Morpheus-panBC)
|
||||
| Primary Endpoint |
Primary efficacy is assessed via Objective Response Rate (ORR) evaluated from baseline until disease progression or loss of clinical benefit (up to ~10 years), alongside long-term monitoring of adverse events throughout the study duration.
|
||||
| Other Endpoint |
Secondary endpoints include Progression-Free Survival (PFS), Disease Control Rate (DCR), Overall Survival (OS) at 12/18 months and overall study duration (up to ~10 years), Duration of Response (DOR), and safety profiles-all per RECIST v1.1-to evaluate treatment durability, disease stabilization, and survival outcomes.
|
||||
| Experiment 7 Reporting the Activity Date of This ADC | [8] | ||||
| Patients Enrolled |
Eligible patients must have newly diagnosed invasive breast cancer (Stage II-III or T4/Nany/M0; tumor ≥2.5cm) without prior chemo/radiation. Key requirements: ECOG 0-1, adequate organ function, MRI compatibility, and biomarker-evaluable tumor (MammaPrint High or ER-/HER2+). Exclusions: metastatic disease, severe cardiac conditions, active infections, or prior investigational drug use within 30 days. Baseline biopsies and serial imaging are mandatory.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT01042379 | Clinical Status | PHASE2 | ||
| Clinical Description |
I-SPY Trial (Investigation of Serial Studies to Predict Your Therapeutic Response With Imaging And moLecular Analysis 2)
|
||||
| Primary Endpoint |
The primary objective is to evaluate if adding experimental agents to standard neoadjuvant chemotherapy improves pathologic complete response (pCR) rates, stratified by biomarker signatures, with assessments conducted post-surgery following up to 36 weeks of treatment.
|
||||
| Other Endpoint |
Secondary goals include developing predictive/prognostic models using biomarkers (from blood/tissue collected at baseline, mid-treatment, and pre/post-surgery) for pCR and residual cancer burden (RCB), while also analyzing 3/5-year relapse-free and overall survival rates. Safety profiles (AEs/SAEs) and treatment response via MRI volumetric changes (at 4 timepoints) will be monitored throughout the study.
Click to Show/Hide
|
||||
| Experiment 8 Reporting the Activity Date of This ADC | [9] | ||||
| Patients Enrolled |
Eligible participants had measurable disease (RECIST v1.1), ECOG 0-1, and progression after prior therapy. Cohort-specific requirements: SCLC (1 prior platinum-based chemo), NSCLC (squamous/nonsquamous; EGFR/ALK/ROS wild-type; 1 prior chemo + anti-PD (L)1), HNSCC (platinum-refractory), esophageal/gastric (HER2-treated if applicable), CRPC (no prior chemo in mCRPC), and melanoma (anti-PD (L)1-refractory, BRAF-treated if mutated). Key exclusions: active CNS metastases, Grade ≥2 neuropathy, interstitial lung disease, or concurrent malignancy within 3 years.
Click to Show/Hide
|
||||
| Administration Dosage |
SGNLVA-005 (NCT04032704) is an open-label, phase 2 study evaluating LV monotherapy in patients with 8 different advanced solid tumors in two parts (administered as a 30 minute intravenous infusion [IV]: Part A LV 2.5 mg/kg IV every 3 weeks [up to n = 72 total]; Part B LV 1.0 or 1.25 mg/kg every 1 week [up to n = 252 total]).
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04032704 | Clinical Status | PHASE2 | ||
| Clinical Description |
Open-Label Phase 2 Study of Ladiratuzumab Vedotin (LV) for Unresectable Locally Advanced or Metastatic Solid Tumors
|
||||
| Primary Endpoint |
The primary efficacy endpoint was Objective Response Rate (ORR) per RECIST v1.1, defined as confirmed complete (disappearance of all target lesions) or partial response (≥30% decrease in lesion diameters) in Part A (up to 8.3 months follow-up) and Part B (up to 34.7 months). For prostate cancer (Cohort 7), PSA response (≥50% reduction confirmed ≥3 weeks apart) was additionally assessed per PCWG3 criteria with a maximum follow-up of 13.5 months.
Click to Show/Hide
|
||||
| Other Endpoint |
Safety profiles-including treatment-emergent adverse events (TEAEs), serious AEs (≥Grade 3), and treatment-related AEs-were monitored up to 37.5 months. Secondary endpoints included Disease Control Rate (DCR: CR/PR/SD), Duration of Response (DOR), Progression-Free Survival (PFS), and Overall Survival (OS), all evaluated per RECIST v1.1. Pharmacokinetics (AUC21/AUC7, Cmax) for ladiratuzumab vedotin (ADC, TAB, MMAE) and antidrug antibody (ATA) incidence were also analyzed.
Click to Show/Hide
|
||||
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [4] | ||||
| Efficacy Data | Half Maximal Effective Concentration (EC50) |
6.3 ng/mL
|
|||
| Method Description |
The inhibitory activity of SGN-LIV1A against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 5 days.
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
References
