General Information of This Antibody (ID: ANI0JSXOC)
Antibody Name
Ladiratuzumab
Organization
Seagen Inc.
Indication
Esophageal squamous cell carcinoma; Melanoma; Prostatic cancer; Small cell lung cancer;
Synonyms
Anti-LIV1 mAb hLIV22
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Zinc transporter ZIP6 (SLC39A6)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGLTIEDYYMHWVRQAPGQGLEWMGWIDPENGDTEY
GPKFQGRVTMTRDTSINTAYMELSRLRSDDTAVYYCAVHNAHYGTWFAYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Light Chain Sequence
DVVMTQSPLSLPVTLGQPASISCRSSQSLLHSSGNTYLEWYQQRPGQSPRPLIYKISTRF
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPYTFGGGTKVEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Ladiratuzumab vedotin [Phase 2 (discontinued)]
Identified from the Human Clinical Data
Click To Hide/Show 8 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
28%
Patients Enrolled
Eligible patients require pathologically confirmed, incurable LA/MBC (subtype-specific criteria for Parts A-F), measurable disease, ECOG 0-1, and adequate organ function; exclusions encompass severe neuropathy (≥Grade 2), untreated CNS metastases, prior LV/MMAE therapy, and trastuzumab hypersensitivity (combination arm). Tumor PD-L1/CPS and LIV-1 expression are mandated for specific cohorts.

   Click to Show/Hide
Administration Dosage
SGNLVA-001 (NCT01969643) is an ongoing, multi-part, open label study investigating the safety and efficacy of LV in patients with metastatic breast cancer (mBC). Part E evaluated LV q1w in escalation and expansion starting at LV 1.0 mg/kg q1w. Patients with first (1L) or second line (2L) endocrine therapy refractory hormone receptor-positive (HR+)/HER2-negative (HER2-) mBC or 2L mTNBC were enrolled. Tumor assessments occurred every 6 weeks per RECIST v1.1.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT01969643  Clinical Status PHASE1
Clinical Description
A Phase 1, Open-Label, Dose-Escalation Study to Evaluate the Safety and Tolerability of SGN-LIV1A in Patients With Metastatic Breast Cancer
Primary Endpoint
Safety assessments include monitoring adverse events (AEs), laboratory abnormalities, and dose-limiting toxicities (DLTs) throughout treatment and up to 1 month post-treatment (approx. 2 years) using descriptive statistics to evaluate tolerability.
Other Endpoint
Pharmacodynamic measures (blood concentrations of LV/metabolites, anti-drug antibodies) and efficacy endpoints (ORR per RECIST v1.1, DOR, PFS, OS, PFS ratio to prior therapy) will be tracked for up to 3-8 years to assess pharmacokinetics, immunogenicity, and clinical response durability.
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligible patients must have untreated metastatic/locally-advanced TNBC (PD-L1 CPS<10 for Part D), measurable lesions (&ge;10mm tumor/&ge;15mm lymph node), ECOG 0-1, and adequate organ function. Key exclusions: prior immuno-oncology therapy, Grade&ge;2 neuropathy, active CNS metastases (unless treated/stable for &ge;4 weeks without steroids), recent radiotherapy (<2 weeks), active autoimmune disease/interstitial lung disease, or steroid-requiring pneumonitis.

   Click to Show/Hide
Administration Dosage
Patients will receive LV at 1.5 mg/kg on Days 1 and 8 plus pembrolizumab 200 mg on Day 1 Q3W.
Related Clinical Trial
NCT Number NCT03310957  Clinical Status PHASE1|||PHASE2
Clinical Description
Single Arm, Open Label Phase 1b/2 Study of SGN-LIV1A in Combination With Pembrolizumab for First-Line Treatment of Patients With Unresectable Locally-Advanced or Metastatic Triple-Negative Breast Cancer
Primary Endpoint
The primary efficacy and safety assessments include confirmed objective response rate (ORR) per RECIST v1.1 evaluated up to 18 weeks post-treatment (~1 year), alongside monitoring of adverse events, laboratory abnormalities, and dose-limiting toxicities throughout treatment and up to 1 month post-treatment (~10 months).
Other Endpoint
Secondary endpoints assessing long-term clinical outcomes include duration of response (DOR), disease control rate (DCR), progression-free survival (PFS), and overall survival (OS), all evaluated per RECIST v1.1 and tracked for up to 2.5 years post-treatment to determine therapeutic durability and survival benefits.
Experiment 3 Reporting the Activity Date of This ADC [3]
Patients Enrolled
Eligible patients must have metastatic/inoperable locally advanced breast cancer (RECIST v1.1 measurable disease), ECOG 0-1, life expectancy &ge;3 months, and adequate organ function. Key exclusions: prior immune checkpoint therapies (anti-PD-1/PD-L1/CTLA-4), active/uncontrolled CNS metastases, autoimmune/immunodeficiency disorders, severe infections, significant cardiovascular disease, recent immunosuppressants, or pregnancy/breastfeeding. Tumor biopsy/biomarker testing is mandatory.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT03424005  Clinical Status PHASE1|||PHASE2
Clinical Description
A Phase Ib/II, Open-Label, Multicenter, Randomized Umbrella Study Evaluating The Efficacy And Safety Of Multiple Treatment Combinations In Patients With Metastatic Breast Cancer (Morpheus-panBC)
Primary Endpoint
Primary efficacy is assessed via Objective Response Rate (ORR) evaluated from baseline until disease progression or loss of clinical benefit (up to ~10 years), alongside long-term monitoring of adverse events throughout the study duration.
Other Endpoint
Secondary endpoints include Progression-Free Survival (PFS), Disease Control Rate (DCR), Overall Survival (OS) at 12/18 months and overall study duration (up to ~10 years), Duration of Response (DOR), and safety profiles-all per RECIST v1.1-to evaluate treatment durability, disease stabilization, and survival outcomes.
Experiment 4 Reporting the Activity Date of This ADC [4]
Patients Enrolled
Eligible patients must have newly diagnosed invasive breast cancer (Stage II-III or T4/Nany/M0; tumor &ge;2.5cm) without prior chemo/radiation. Key requirements: ECOG 0-1, adequate organ function, MRI compatibility, and biomarker-evaluable tumor (MammaPrint High or ER-/HER2+). Exclusions: metastatic disease, severe cardiac conditions, active infections, or prior investigational drug use within 30 days. Baseline biopsies and serial imaging are mandatory.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT01042379  Clinical Status PHASE2
Clinical Description
I-SPY Trial (Investigation of Serial Studies to Predict Your Therapeutic Response With Imaging And moLecular Analysis 2)
Primary Endpoint
The primary objective is to evaluate if adding experimental agents to standard neoadjuvant chemotherapy improves pathologic complete response (pCR) rates, stratified by biomarker signatures, with assessments conducted post-surgery following up to 36 weeks of treatment.
Other Endpoint
Secondary goals include developing predictive/prognostic models using biomarkers (from blood/tissue collected at baseline, mid-treatment, and pre/post-surgery) for pCR and residual cancer burden (RCB), while also analyzing 3/5-year relapse-free and overall survival rates. Safety profiles (AEs/SAEs) and treatment response via MRI volumetric changes (at 4 timepoints) will be monitored throughout the study.

   Click to Show/Hide
Experiment 5 Reporting the Activity Date of This ADC [5]
Patients Enrolled
Eligible participants had measurable disease (RECIST v1.1), ECOG 0-1, and progression after prior therapy. Cohort-specific requirements: SCLC (1 prior platinum-based chemo), NSCLC (squamous/nonsquamous; EGFR/ALK/ROS wild-type; 1 prior chemo + anti-PD (L)1), HNSCC (platinum-refractory), esophageal/gastric (HER2-treated if applicable), CRPC (no prior chemo in mCRPC), and melanoma (anti-PD (L)1-refractory, BRAF-treated if mutated). Key exclusions: active CNS metastases, Grade &ge;2 neuropathy, interstitial lung disease, or concurrent malignancy within 3 years.

   Click to Show/Hide
Administration Dosage
SGNLVA-005 (NCT04032704) is an open-label, phase 2 study evaluating LV monotherapy in patients with 8 different advanced solid tumors in two parts (administered as a 30 minute intravenous infusion [IV]: Part A LV 2.5 mg/kg IV every 3 weeks [up to n = 72 total]; Part B LV 1.0 or 1.25 mg/kg every 1 week [up to n = 252 total]).
Related Clinical Trial
NCT Number NCT04032704  Clinical Status PHASE2
Clinical Description
Open-Label Phase 2 Study of Ladiratuzumab Vedotin (LV) for Unresectable Locally Advanced or Metastatic Solid Tumors
Primary Endpoint
The primary efficacy endpoint was Objective Response Rate (ORR) per RECIST v1.1, defined as confirmed complete (disappearance of all target lesions) or partial response (≥30% decrease in lesion diameters) in Part A (up to 8.3 months follow-up) and Part B (up to 34.7 months). For prostate cancer (Cohort 7), PSA response (≥50% reduction confirmed ≥3 weeks apart) was additionally assessed per PCWG3 criteria with a maximum follow-up of 13.5 months.

   Click to Show/Hide
Other Endpoint
Safety profiles-including treatment-emergent adverse events (TEAEs), serious AEs (≥Grade 3), and treatment-related AEs-were monitored up to 37.5 months. Secondary endpoints included Disease Control Rate (DCR: CR/PR/SD), Duration of Response (DOR), Progression-Free Survival (PFS), and Overall Survival (OS), all evaluated per RECIST v1.1. Pharmacokinetics (AUC21/AUC7, Cmax) for ladiratuzumab vedotin (ADC, TAB, MMAE) and antidrug antibody (ATA) incidence were also analyzed.

   Click to Show/Hide
Experiment 6 Reporting the Activity Date of This ADC [6]
Efficacy Data Objective Response Rate (ORR)
35%
Patients Enrolled
Unresectable locally advanced or metastatic triple-negative breast cancer (mTNBC). Patients must have measureable disease per RECIST v1.1, an ECOG score of 0 or 1, and no prior cytotoxic or anti-PD-L1 treatment for advanced disease.
Administration Dosage
LV 2.50 mg/kg + pembrolizumab 200 mg intravenously every three weeks.
Related Clinical Trial
NCT Number NCT03310957  Clinical Status Phase 1/2
Clinical Description
Single arm, open label phase 1b/2 study of SGN-LIV1A in combination with pembrolizumab for first-line treatment of patients with unresectable locally-advanced or metastatic triple-negative breast cancer.
Experiment 7 Reporting the Activity Date of This ADC [7]
Efficacy Data Objective Response Rate (ORR)
32%
Patients Enrolled
Women with LIV-1-positive, unresectable, locally advanced or metastatic breast cancer (LA/MBC).
Administration Dosage
Received a median of 3 cycles (range, 112) of SGN-LIV1A at doses of 0.50-2.80 mg/kg.
Related Clinical Trial
NCT Number NCT01969643  Clinical Status Phase 1
Clinical Description
A phase 1, open-label, dose-escalation study to evaluate the safety and tolerability of SGN-LIV1A in patients with metastatic breast cancer.
Experiment 8 Reporting the Activity Date of This ADC [8]
Related Clinical Trial
NCT Number NCT04032704  Clinical Status Phase 2
Clinical Description
Open-label phase 2 study of ladiratuzumab vedotin (LV) for unresectable locally advanced or metastatic solid tumors.
Revealed Based on the Cell Line Data
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [9]
Efficacy Data Half Maximal Effective Concentration (EC50)
6.3 ng/mL
Method Description
The inhibitory activity of SGN-LIV1A against cancer cell growth was evaluated in various human cancer cell lines in vitro. The cells were treated 5 days.
In Vitro Model Invasive breast carcinoma MCF-7 cells CVCL_0031
References
Ref 1 A Safety Study of SGN-LIV1A in Breast Cancer Patients
Ref 2 Safety and Efficacy of SGN-LIV1A Plus Pembrolizumab for Patients With Locally-Advanced or Metastatic Triple-Negative Breast Cancer
Ref 3 A Study Evaluating the Efficacy and Safety of Multiple Treatment Combinations in Patients With Metastatic or Locally Advanced Breast Cancer
Ref 4 I-SPY TRIAL: Neoadjuvant and Personalized Adaptive Novel Agents to Treat Breast Cancer
Ref 5 A Study of Ladiratuzumab Vedotin in Advanced Solid Tumors
Ref 6 Phase 1 study of the antibody-drug conjugate SGN-LIV1A in patients with heavily pretreated triple-negative metastatic breast cancer. Cancer Res (2018) 78 (4_Supplement): PD3-14.
Ref 7 Ladiratuzumab vedotin for metastatic triple negative cancer: preliminary results, key challenges, and clinical potential. Expert Opin Investig Drugs. 2022 Jun;31(6):495-498. doi: 10.1080/13543784.2022.2042252.
Ref 8 Open-Label Phase 2 Study of Ladiratuzumab Vedotin (LV) for Unresectable Locally Advanced or Metastatic Solid Tumors, NCT04032704
Ref 9 SGN-LIV1A: a novel antibody-drug conjugate targeting LIV-1 for the treatment of metastatic breast cancer. Mol Cancer Ther. 2014 Dec;13(12):2991-3000.