Antibody Information
General Information of This Antibody (ID: ANI0GTOLK)
| Antibody Name | Raludotatug |
|||||
|---|---|---|---|---|---|---|
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Cadherin-6 (CDH6) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVQSGAEVKKPGASVKVSCKASGYTFTRNFMHWVRQAPGQGLEWMGWIYPGDGETEY
AQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCARGVYGGFAGGYFDFWGQGTLVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR EEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCKASQNIYKNLAWYQQKPGKAPKLLIYDANTLQTGVPS
RFSGSGSGSDFTLTISSLQPEDFATYFCQQYYSGWAFGQGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Raludotatug deruxtecan [Phase 2/3]
Identified from the Human Clinical Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Patients Enrolled |
Eligibility requires unresectable/metastatic gastrointestinal cancers (PDAC, CCA/GBC, colorectal, gastric/GEJ/EAC) with prior therapy and ≥3-month life expectancy; exclusions include active ILD/pneumonitis, uncontrolled cardiovascular disease, progressing malignancies, untreated CNS metastases, autoimmune disease requiring recent treatment, or major surgery complications. HIV+ candidates must have controlled viral loads without Kaposi's sarcoma/Castleman's disease history.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06864169 | Clinical Status | PHASE2 | ||
| Clinical Description |
A Phase 2 Nonrandomized, Open-label, Multisite Study to Evaluate the Safety and Efficacy of Raludotatug Deruxtecan in Participants With Gastrointestinal Cancers
|
||||
| Primary Endpoint |
The primary efficacy endpoint is objective response rate (ORR) assessed by BICR per RECIST 1.1, defined as confirmed complete response (CR) or partial response (PR) observed in approximately 15 months, with tumor responses requiring ≥30% reduction in target lesions.
|
||||
| Other Endpoint |
Safety assessments include incidence of adverse events (AEs) over 14 months and treatment discontinuations due to AEs within 12 months. Key secondary endpoints are duration of response (DOR), progression-free survival (PFS), and overall survival (OS)-all tracked up to 49 months-with disease progression defined as ≥20% tumor growth plus ≥5 mm absolute increase or new lesions by RECIST 1.1 via BICR.
Click to Show/Hide
|
||||
| Experiment 2 Reporting the Activity Date of This ADC | [2] | ||||
| Patients Enrolled |
Key inclusion criteria: age ≥18, ECOG PS 0-1, preserved LVEF (≥50%), adequate organ function, and contraception compliance. Exclusion criteria: prior CDH6/ADC therapy (exatecan-based), active CNS metastases (unless stable post-treatment), multiple primary malignancies (unless disease-free ≥3 years), significant cardiac history (e.g., MI within 6 months, CHF NYHA II-IV), uncontrolled infections, or active pulmonary diseases. Tumor tissue archival is mandatory.
Click to Show/Hide
|
||||
| Administration Dosage |
Intravenous administration at doses starting at 1.6 mg/kg on Day 1 of Cycle 1
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04707248 | Clinical Status | PHASE1 | ||
| Clinical Description |
Phase I, Two-Part, Multi-Center, First-in-Human Study of DS-6000a in Subjects With Advanced Renal Cell Carcinoma and Ovarian Tumors
|
||||
| Primary Endpoint |
The study evaluates dose-limiting toxicities (DLTs) occurring within 21 days in Cycle 1, treatment-emergent adverse events (TEAEs) up to 40 days post-treatment, and objective response rate (ORR) per RECIST v1.1 with assessments spanning up to 52 months. ORR is defined as the proportion of participants achieving complete response (CR) or partial response (PR).
Click to Show/Hide
|
||||
| Other Endpoint |
Pharmacokinetic analyses for R-DXd and metabolites include AUC (21d), AUClast, Cmax, Ctrough, and Tmax across multiple cycles (21-day duration). Efficacy endpoints include ORR (investigator-assessed), duration of response (DoR), disease control rate (DCR), clinical benefit rate (CBR), time to response (TTR), progression-free survival (PFS), and anti-drug antibody (ADA) assessment up to 52 months. DCR and CBR further incorporate stable disease (SD) criteria lasting ≥180 days.
Click to Show/Hide
|
||||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Patients Enrolled |
Eligible participants must have Stage IV squamous NSCLC, prior progression on anti-PD- (L)1 and platinum chemotherapy, controlled HIV/HBV/HCV if applicable, while exclusions involve uncontrolled cardiovascular/pulmonary disease, active infections, CNS metastases, autoimmune disorders requiring recent treatment, concurrent malignancies, prior transplants, or unresolved surgery complications.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06780098 | Clinical Status | PHASE2 | ||
| Clinical Description |
KEYMAKER-U01 Substudy 01I: A Phase 2, Randomized, Umbrella Study With Rolling Arms of Investigational Agents in Participants With Previously Treated Stage IV Squamous Non-small Cell Lung Cancer (NSCLC)
|
||||
| Primary Endpoint |
The primary objectives include assessing Objective Response Rate (ORR) as the percentage of participants achieving Complete Response (CR) or Partial Response (PR) per RECIST 1.1, evaluated by Blinded Independent Central Review (BICR), along with the reporting of adverse events (AEs) and treatment discontinuations due to AEs over an 84-month timeframe.
Click to Show/Hide
|
||||
| Other Endpoint |
Key secondary endpoints encompass Duration of Response (DOR), defined as the time from first documented CR/PR to progression or death, Progression-Free Survival (PFS) measured from randomization to disease progression or death, and Overall Survival (OS), calculated as the time from randomization to death from any cause, all assessed per RECIST 1.1 by BICR.
Click to Show/Hide
|
||||
| Experiment 4 Reporting the Activity Date of This ADC | [4] | ||||
| Patients Enrolled |
Key inclusion requires Stage IV nonsquamous NSCLC (EGFR-/ALK-/ROS1-) post anti-PDL1/platinum failure with measurable disease, adequate organ function, and controlled infections (HIV/HBV/HCV), while exclusions involve recent radiotherapy, uncontrolled comorbidities, active infections/CNS metastases, immune disorders, transplant history, or unresolved surgical issues, maintaining rigorous patient selection criteria.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06780085 | Clinical Status | PHASE2 | ||
| Clinical Description |
KEYMAKER-U01 Substudy 01H: A Phase 2, Randomized, Umbrella Study With Rolling Arms of Investigational Agents in Participants With Previously Treated Stage IV Nonsquamous Non-small Cell Lung Cancer (NSCLC)
|
||||
| Primary Endpoint |
The primary outcomes include Objective Response Rate (ORR) assessing CR/PR per RECIST 1.1 via BICR over 60 months, along with AE incidence (over 25 months) and treatment discontinuation due to AEs (over 24 months), focusing on safety and efficacy signals in the study population.
|
||||
| Other Endpoint |
Secondary measures comprise Duration of Response (60 months), Progression-Free Survival (60 months), and Overall Survival (84 months), all evaluated according to RECIST 1.1 criteria with tumor progression defined by ≥20% lesion increase plus ≥5mm absolute growth, using BICR assessment for standardized evaluation.
|
||||
| Experiment 5 Reporting the Activity Date of This ADC | [5] | ||||
| Patients Enrolled |
Eligible participants were adults with platinum-resistant high-grade ovarian, peritoneal, or fallopian tube cancer (1-3 prior lines, including bevacizumab) having measurable lesions and adequate organ function. Key exclusions included active ILD, uncontrolled cardiovascular disease, prior CDH6/exatecan-derivative therapy, HIV/HBV/HCV infections (unless controlled), and pregnancy. Phase 3 participants had to qualify for investigator-choice chemotherapy.
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06161025 | Clinical Status | PHASE2|||PHASE3 | ||
| Clinical Description |
A Phase 2/3, Multicenter, Randomized Study of Raludotatug Deruxtecan (R-DXd), a CDH6-directed Antibody-drug Conjugate, in Subjects With Platinum-resistant, High-grade Ovarian, Primary Peritoneal, or Fallopian Tube Cancer
|
||||
| Primary Endpoint |
The study assessed Objective Response Rate (ORR) via Blinded Independent Central Review (BICR) in Part A (up to 18 months) and Part B (up to 16 months), defined as confirmed Complete or Partial Response per RECIST 1.1. Progression-free Survival (PFS) in Part B (up to 26 months) measured time from randomization to disease progression or death.
|
||||
| Other Endpoint |
Secondary endpoints included ORR via Investigator assessment (up to 30 months), Duration of Response (DoR, up to 40 months), Disease Control Rate (DCR, up to 40 months), Overall Survival (OS, up to 40 months), and safety metrics including Treatment-emergent Adverse Events (TEAEs). Pharmacokinetic parameters (Cmax, Tmax, AUC, t1/2) and immunogenicity (ADA) were analyzed alongside biomarker correlations (CDH6, CA-125) and quality-of-life assessments.
Click to Show/Hide
|
||||
| Experiment 6 Reporting the Activity Date of This ADC | [6] | ||||
| Patients Enrolled |
Eligible participants must be ≥18 years old with measurable disease (RECIST 1.1), ECOG 0-1, and progression post-systemic therapy. Cohort-specific criteria apply (e.g., prior PD-1/VEGF-TKI for ccRCC, ≥1 line for endometrial/cervical cancer). Key exclusions include active brain metastases, recent thromboembolic events, unresolved toxicities (>Grade 1), ILD/pneumonitis history, prior CDH6/exatecan ADC exposure, or uncontrolled infections (HIV/HBV/HCV).
Click to Show/Hide
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT06660654 | Clinical Status | PHASE2 | ||
| Clinical Description |
REJOICE-PanTumor01: A Phase 2, Multicenter, Open-Label, Pan-Tumor Trial to Evaluate Efficacy and Safety of Raludotatug Deruxtecan (R-DXd) in Participants With Advanced/Metastatic Solid Tumors
|
||||
| Primary Endpoint |
The primary outcomes include Objective Response Rate (ORR) assessed by investigators (excluding ccRCC cohort), defined as the proportion of patients achieving confirmed complete or partial response per RECIST 1.1. For the ccRCC cohort, Disease Control Rate (DCR) is the main endpoint, counting patients with confirmed responses or stable disease lasting ≥5 weeks. Additionally, safety metrics (TEAEs, SAEs, AESIs) across all cohorts will be monitored up to 32 months.
Click to Show/Hide
|
||||
| Other Endpoint |
Secondary endpoints include Progression-Free Survival (PFS), Duration of Response (DoR), and Time to Response (TTR), all evaluated per RECIST 1.1. ORR and DCR are also secondary measures for specific cohorts (ccRCC or non-ccRCC). Pharmacokinetic analysis of R-DXd (Cmax) and anti-drug antibody (ADA) incidence will be assessed periodically up to 32 months.
Click to Show/Hide
|
||||
| Experiment 7 Reporting the Activity Date of This ADC | [7] | ||||
| Efficacy Data | Objective Response Rate (ORR) |
13.30%
|
|||
| Patients Enrolled |
Patients with advanced renal cell carcinoma or ovarian cancer. Patients had received a median of 4 prior systemic therapy.
|
||||
| Administration Dosage |
First dose was 1.60 mg/kg followed by 3.20, 4.80, 6.40, 8.00, and 9.60 mg/kg every 3 weeks.
|
||||
| Related Clinical Trial | |||||
| NCT Number | NCT04707248 | Clinical Status | Phase 1 | ||
| Clinical Description |
Phase 1, two-part, multi-center, first-in-human study of DS-6000A in subjects with advanced renal cell carcinoma and ovarian tumors.
|
||||
References
