General Information of This Antibody
Antibody ID
ANI0FEDHX
Antibody Name
Fcab-2
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1 Fcab
Antigen Name
Epidermal growth factor receptor (EGFR)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVAVSHEDPEVKFNWYVDGVEVHNAKTK
PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT
LPPSRDELDEGGPVSLTCLVKGFYPSDIAVEWESTYGPENNYKTTPPVLDSDGSFFLYSK
LTVSYWRWVKGNVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Fcab-2-MMAE [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50)
0.19±0.05 nM
High EGFR expression (EGFR+++/++)
Method Description
The inhibitory activity of Fcab-2-MMAE against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal Inhibitory Concentration (IC50) > 100.00 nM Negative EGFR expression (EGFR-)
Method Description
The inhibitory activity of Fcab-2-MMAE against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Invasive breast carcinoma MCF-7 cells CVCL_0031
Experiment 3 Reporting the Activity Date of This ADC [2]
Efficacy Data Half Maximal Effective Concentration (EC50)
1.40 nM
Low FOLR1 expression (FOLR1+)
Method Description
The inhibitory activity of Fcab-2-MMAE against cancer cell growth was evaluated in various human cancer cell lines in vitro.
In Vitro Model Skin squamous cell carcinoma A431 cells CVCL_0037
References
Ref 1 EGFR binding Fc domain-drug conjugates: stable and highly potent cytotoxic molecules mediate selective cell killing. Biol Chem. 2021 Sep 20;403(5-6):525-534.
Ref 2 Discovery of STRO-002, a Novel Homogeneous ADC Targeting Folate Receptor Alpha, for the Treatment of Ovarian and Endometrial Cancers. Mol Cancer Ther. 2023 Feb 1;22(2):155-167.