General Information of This Antibody
Antibody ID
ANI0DRXZT
Antibody Name
hmAb-C
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
CD276 antigen (CD276)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVKPGGSERISCAASGFTFSSYGMSWVRQAPGKGLEWVATINSGGSNTYY
PDSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARHDGGAMDYWGQGTIVTVSS
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASESIYSYLAWYQQKPGKAPKLLVYNTKTLPEGVPS
RFSGSGSGTDFTLTISSIQPEDFATYYCQHHYGTPPWTFGQGTRLEIK
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
hmAb-C-DUBA [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 17 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 42.39% (Day 59) Moderate CD276 expression (CD276 ++)
Method Description
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
In Vivo Model PA-1 CDX model
In Vitro Model Ovarian mixed germ cell tumor PA-1 cells CVCL_0479
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 43.85% (Day 70) Moderate CD276 expression (CD276 ++)
Method Description
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
In Vivo Model PA-1 CDX model
In Vitro Model Ovarian mixed germ cell tumor PA-1 cells CVCL_0479
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 49.48% (Day 110) Moderate CD276 expression (CD276 ++)
Method Description
MDA-MB-468 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
In Vivo Model MDA-MB-468 CDX model
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 59.20% (Day 54) Moderate CD276 expression (CD276 ++)
Method Description
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
In Vivo Model Calu-6 CDX model
In Vitro Model Lung adenocarcinoma Calu-6 cells CVCL_0236
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 76.07% (Day 70) Moderate CD276 expression (CD276 ++)
Method Description
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg) at Day 20.
In Vivo Model PA-1 CDX model
In Vitro Model Ovarian mixed germ cell tumor PA-1 cells CVCL_0479
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 83.49% (Day 70) Moderate CD276 expression (CD276 ++)
Method Description
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg x 2) at Day 20.
In Vivo Model PA-1 CDX model
In Vitro Model Ovarian mixed germ cell tumor PA-1 cells CVCL_0479
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 84.42% (Day 62) Moderate CD276 expression (CD276 ++)
Method Description
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted intogroups of mice (n=5) essentially, which then received doses of hmAb-C-DUBA (1 mg/kg x 3) at Day 24, 31, 38 and 45 post inoculation, and the animals were evaluated for tumor volume for up to 62 days.
In Vivo Model Calu-6 CDX model
In Vitro Model Lung adenocarcinoma Calu-6 cells CVCL_0236
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 85.17% (Day 61) Moderate CD276 expression (CD276 ++)
Method Description
A375.52 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
In Vivo Model A375.52 CDX model
In Vitro Model Amelanotic melanoma A375.S2 cells CVCL_0136
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 88.65% (Day 59) Moderate CD276 expression (CD276 ++)
Method Description
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg) at Day 20.
In Vivo Model PA-1 CDX model
In Vitro Model Ovarian mixed germ cell tumor PA-1 cells CVCL_0479
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90.47% (Day 62) Moderate CD276 expression (CD276 ++)
Method Description
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted intogroups of mice (n=5) essentially, which then received doses of hmAb-C-DUBA (3 mg/kg x 3) at Day 24, 31, 38 and 45 post inoculation, and the animals were evaluated for tumor volume for up to 62 days.
In Vivo Model Calu-6 CDX model
In Vitro Model Lung adenocarcinoma Calu-6 cells CVCL_0236
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 91.81% (Day 54) Moderate CD276 expression (CD276 ++)
Method Description
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg) at Day 20.
In Vivo Model Calu-6 CDX model
In Vitro Model Lung adenocarcinoma Calu-6 cells CVCL_0236
Experiment 12 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 92.95% (Day 59) Moderate CD276 expression (CD276 ++)
Method Description
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (6 mg/kg) at Day 20.
In Vivo Model PA-1 CDX model
In Vitro Model Ovarian mixed germ cell tumor PA-1 cells CVCL_0479
Experiment 13 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 97.20% (Day 62) Moderate CD276 expression (CD276 ++)
Method Description
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted intogroups of mice (n=5) essentially, which then received doses of hmAb-C-DUBA (6 mg/kg x 3) at Day 24, 31, 38 and 45 post inoculation, and the animals were evaluated for tumor volume for up to 62 days.
In Vivo Model Calu-6 CDX model
In Vitro Model Lung adenocarcinoma Calu-6 cells CVCL_0236
Experiment 14 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.30% (Day 100) Moderate CD276 expression (CD276 ++)
Method Description
MDA-MB-468 cells were subcutaneously implanted intogroups of mice (n=5) essentially, which then received doses of hmAb-C-DUBA (3 mg/kg x 3), and the animals were evaluated for tumor volume for up to 110 days.
In Vivo Model MDA-MB-468 CDX model
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 15 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.92% (Day 61) Moderate CD276 expression (CD276 ++)
Method Description
A375.52 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (6 mg/kg) at Day 20.
In Vivo Model A375.52 CDX model
In Vitro Model Amelanotic melanoma A375.S2 cells CVCL_0136
Experiment 16 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.97% (Day 110) Moderate CD276 expression (CD276 ++)
Method Description
MDA-MB-468 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (6 mg/kg) at Day 20.
In Vivo Model MDA-MB-468 CDX model
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 17 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 99.24% (Day 70) Moderate CD276 expression (CD276 ++)
Method Description
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg x 4) at Day 20.
In Vivo Model PA-1 CDX model
In Vitro Model Ovarian mixed germ cell tumor PA-1 cells CVCL_0479
References
Ref 1 Novel b7-h3 binding molecules, antibody drug conjugates thereof and methods of use thereof; 2017-10-19.