Antibody Information
General Information of This Antibody (ID: ANI0DRXZT)
| Antibody Name | hmAb-C |
|||||
|---|---|---|---|---|---|---|
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | CD276 antigen (CD276) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGGGLVKPGGSERISCAASGFTFSSYGMSWVRQAPGKGLEWVATINSGGSNTYY
PDSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARHDGGAMDYWGQGTIVTVSS Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCRASESIYSYLAWYQQKPGKAPKLLVYNTKTLPEGVPS
RFSGSGSGTDFTLTISSIQPEDFATYYCQHHYGTPPWTFGQGTRLEIK Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
HmAb-C-DUBA [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 42.39% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
|
||||
| In Vivo Model | PA-1 CDX model | ||||
| In Vitro Model | Ovarian mixed germ cell tumor | PA-1 cells | CVCL_0479 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 43.85% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
|
||||
| In Vivo Model | PA-1 CDX model | ||||
| In Vitro Model | Ovarian mixed germ cell tumor | PA-1 cells | CVCL_0479 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 49.48% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
MDA-MB-468 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
|
||||
| In Vivo Model | MDA-MB-468 CDX model | ||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 59.20% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
|
||||
| In Vivo Model | Calu-6 CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | Calu-6 cells | CVCL_0236 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 76.07% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg) at Day 20.
|
||||
| In Vivo Model | PA-1 CDX model | ||||
| In Vitro Model | Ovarian mixed germ cell tumor | PA-1 cells | CVCL_0479 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 83.49% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg x 2) at Day 20.
|
||||
| In Vivo Model | PA-1 CDX model | ||||
| In Vitro Model | Ovarian mixed germ cell tumor | PA-1 cells | CVCL_0479 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 84.42% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted intogroups of mice (n=5) essentially, which then received doses of hmAb-C-DUBA (1 mg/kg x 3) at Day 24, 31, 38 and 45 post inoculation, and the animals were evaluated for tumor volume for up to 62 days.
|
||||
| In Vivo Model | Calu-6 CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | Calu-6 cells | CVCL_0236 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 85.17% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
A375.52 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (3 mg/kg) at Day 20.
|
||||
| In Vivo Model | A375.52 CDX model | ||||
| In Vitro Model | Amelanotic melanoma | A375.S2 cells | CVCL_0136 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 88.65% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg) at Day 20.
|
||||
| In Vivo Model | PA-1 CDX model | ||||
| In Vitro Model | Ovarian mixed germ cell tumor | PA-1 cells | CVCL_0479 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 90.47% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted intogroups of mice (n=5) essentially, which then received doses of hmAb-C-DUBA (3 mg/kg x 3) at Day 24, 31, 38 and 45 post inoculation, and the animals were evaluated for tumor volume for up to 62 days.
|
||||
| In Vivo Model | Calu-6 CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | Calu-6 cells | CVCL_0236 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 91.81% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg) at Day 20.
|
||||
| In Vivo Model | Calu-6 CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | Calu-6 cells | CVCL_0236 | ||
| Experiment 12 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 92.95% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (6 mg/kg) at Day 20.
|
||||
| In Vivo Model | PA-1 CDX model | ||||
| In Vitro Model | Ovarian mixed germ cell tumor | PA-1 cells | CVCL_0479 | ||
| Experiment 13 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 97.20% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
Calu-6 non-small cell lung carcinoma cells were subcutaneously implanted intogroups of mice (n=5) essentially, which then received doses of hmAb-C-DUBA (6 mg/kg x 3) at Day 24, 31, 38 and 45 post inoculation, and the animals were evaluated for tumor volume for up to 62 days.
|
||||
| In Vivo Model | Calu-6 CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | Calu-6 cells | CVCL_0236 | ||
| Experiment 14 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.30% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
MDA-MB-468 cells were subcutaneously implanted intogroups of mice (n=5) essentially, which then received doses of hmAb-C-DUBA (3 mg/kg x 3), and the animals were evaluated for tumor volume for up to 110 days.
|
||||
| In Vivo Model | MDA-MB-468 CDX model | ||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 15 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.92% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
A375.52 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (6 mg/kg) at Day 20.
|
||||
| In Vivo Model | A375.52 CDX model | ||||
| In Vitro Model | Amelanotic melanoma | A375.S2 cells | CVCL_0136 | ||
| Experiment 16 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.97% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
MDA-MB-468 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (6 mg/kg) at Day 20.
|
||||
| In Vivo Model | MDA-MB-468 CDX model | ||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 17 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 99.24% | Moderate CD276 expression (CD276 ++) | ||
| Method Description |
PA-1 cells were subcutaneously implanted into groups of mice(n=7), which then received a single dose of hmAb-C-DUBA or Ctrl-DUBA (10 mg/kg x 4) at Day 20.
|
||||
| In Vivo Model | PA-1 CDX model | ||||
| In Vitro Model | Ovarian mixed germ cell tumor | PA-1 cells | CVCL_0479 | ||
References
