Antibody ID	ANI0DEWGN
Antibody Name	Vandortuzumab
Organization	Genentech, Inc.
Indication	Prostate cancer
Synonyms	DSTP3086S; MSTP2109A; RG7450;    Click to Show/Hide
Antibody Type	Monoclonal antibody (mAb)
Antibody Subtype	Humanized IgG1-kappa
Antigen Name	Metalloreductase STEAP1 (STEAP1)					Antigen Info
ChEMBI ID	CHEMBL3833356
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence	EVQLVESGGGLVQPGGSLRLSCAVSGYSITSDYAWNWVRQAPGKGLEWVGYISNSGSTSY NPSLKSRFTISRDTSKNTLYLQMNSLRAEDTAVYYCARERNYDYDDYYYAMDYWGQGTLV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK     Click to Show/Hide
Light Chain Sequence	DIQMTQSPSSLSASVGDRVTITCKSSQSLLYRSNQKNYLAWYQQKPGKAPKLLIYWASTR ESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYYNYPRTFGQGTKVEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC     Click to Show/Hide

Experiment 1 Reporting the Activity Date of This ADC					[1]
Efficacy Data	Partial Response (PR)	4%
Patients Enrolled	Metastatic castration-resistant prostate cancer (CRPC).
Administration Dosage	3 + 3 dose escalation study, 0.30 to 2.80 mg/kg intravenously given once every 3 weeks followed by cohort expansion at the recommended phase II dose or weekly (0.80 to 1.00 mg/kg).
Related Clinical Trial
NCT Number	NCT01283373	Clinical Status	Phase 1
Clinical Description	A phase 1, open-label study of the safety and pharmacokinetics of escalating doses of DSTP3086S in patients with metastatic castration-resistant prostate cancer.
Primary Endpoint	DsTP3086S has acceptable safety at the recommended phase II dose level of 2.40 mg/kg once every 3 weeks.
Experiment 2 Reporting the Activity Date of This ADC					[2]
Related Clinical Trial
NCT Number	NCT01283373	Clinical Status	Phase 1
Clinical Description	A phase 1, open-label study of the safety and pharmacokinetics of escalating doses of DSTP3086S in patients with metastatic castration-resistant prostate cancer.
Experiment 3 Reporting the Activity Date of This ADC					[3]
Patients Enrolled	Eligible patients require metastatic castration-resistant prostate cancer (≤2 prior chemo regimens for expansion cohort), ECOG 0-2, and measurable disease. Key exclusions include recent anticancer therapy (4-week washout), active infections, uncontrolled CNS metastases (>8 weeks post-radiotherapy if treated), corticosteroids >10mg/day prednisone, or prior mAb hypersensitivity.    Click to Show/Hide
Administration Dosage	This study evaluated safety and activity of DSTP3086S (0.3-2.8 mg/kg IV) given every 3 weeks (q3w) to pts with CRPC.
Related Clinical Trial
NCT Number	NCT01283373	Clinical Status	PHASE1
Clinical Description	A Phase I, Open-Label Study of the Safety and Pharmacokinetics of Escalating Doses of DSTP3086S in Patients With Metastatic Castration-Resistant Prostate Cancer
Primary Endpoint	Safety will be assessed through DLT monitoring during the first 21-day cycle to determine treatment tolerability.
Other Endpoint	Comprehensive PK analyses including AUC, Cmax/Cmin, clearance, half-life, and volume of distribution will be conducted over a 1-year period to characterize drug exposure and metabolism.

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.011 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.012 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	4.28 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.011 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.012 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	4.28 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.013 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.014 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	5.35 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.014 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.02 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	5.98 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.014 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.02 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	5.98 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.019 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.025 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	6.12 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.019 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.025 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	6.12 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.032 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.049 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	9.85 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.036 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.052 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	5.86 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.038 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.045 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	9.65 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.038 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.052 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	7.95 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.038 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.046 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	8.35 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.039 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.047 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	8.28 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.039 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.047 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	8.28 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.045 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.065 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	5.85 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.045 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.059 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	7.86 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.045 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.065 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	5.85 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.048 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.065 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	5.23 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.048 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.065 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	5.23 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.049 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.058 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	6.88 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.052 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.064 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	9.72 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.052 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1 and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.064 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	9.72 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.053 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.062 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	8.95 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.053 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.062 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	8.95 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.055 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.085 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	12.9 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.055 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.085 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	12.9 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.058 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.065 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	7.9 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.075 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.093 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	11.7 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.075 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.082 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10.8 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.075 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.093 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	11.7 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.075 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.082 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10.8 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.078 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.095 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10.5 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.078 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.098 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	7.35 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.078 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.095 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10.5 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.078 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.098 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	7.35 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.08 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.095 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	11.9 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.08 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.087 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	9.45 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.08 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.095 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	11.9 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.08 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.087 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	9.45 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.085 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.11 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10.9 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.085 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.11 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10.9 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.13 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.16 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	69.5 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.13 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.16 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	69.5 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.135 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.821 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	255.6 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.135 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.821 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	255.6 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.18 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.25 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	42.3 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.18 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.25 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	42.3 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.19 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.35 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	10.6 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.37 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.48 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	22.75 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.39 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.47 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	24.5 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.39 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.47 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	24.5 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.56 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.72 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	27.5 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.56 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.72 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	27.5 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.6 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.69 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	22.8 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.68 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.75 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	28.9 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.68 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.75 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	28.9 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.81 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.85 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	68.3 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.81 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.85 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	68.3 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.85 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.95 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	22.3 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.89 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.07 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	51.8 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.89 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.07 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	51.8 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.95 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.25 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	52.5 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.95 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.08 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	16.2 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	0.95 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	1.25 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	52.5 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	8.15 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of C4-2B, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	12.08 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of PC3-4H7, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	PC3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	336.5 nM
Method Description	MTT assays of the Steap1-ADCs against tumor cells of 22RV1, at 6000 cells, 96 h incubation
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Experiment 1 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	8.15 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	C4-2B is both Steap1 and PSMA antigen high express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	C4-2B cells		CVCL_4784
Experiment 2 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	12.08 nM	High Steap1 and PSMA expression (Steapl and PSMA +++)
Method Description	PC-3-4H7 cell is both Steap1and PSMA antigen high express cells. To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	PC-3-4H7 cells		Homo sapiens
Experiment 3 Reporting the Activity Date of This ADC					[4]
Efficacy Data	Half Maximal inhibitory Concentration (lC50)	336.5 nM	Low Steap1 and PSMA expression (Steap1 and PSMA+)
Method Description	22RV1 is both Steapl and PSMA antigen low express cells.To run the assay,the cells (180 ul,6000cells)were added to each well in a 96-well plate and incubated for 24 hours at 37°C with 5%CO 2. Next,the cells were treated with test compounds (20ul)at various concentrations in appropriate cell culture medium (total volume,0.2 mL).The control wells contain cells and the medium but lack the test compounds.The plates were incubated for 120 hours at 37°C with 5%CO 2.MTT (5 mg/mL)was then added to the wells (20ul)and the plates were incubated for 1.5 hr at 37°C.The medium was carefully removed and DMSO (180ul)was added afterward.After it was shaken for 15min, the absorbance was measured at 490 nm and 570 nm with a reference filter of 620 nm.The inhibition% was calculated according to the following equation:inhibition%=[1- (assay-blank)/ (control-blank)]× 100.    Click to Show/Hide
In Vitro Model	Prostate carcinoma	22RV1 cells		CVCL_1045

Ref 1	Phase I Study of DSTP3086S, an Antibody-Drug Conjugate Targeting Six-Transmembrane Epithelial Antigen of Prostate 1, in Metastatic Castration-Resistant Prostate Cancer. J Clin Oncol. 2019 Dec 20;37(36):3518-3527.
Ref 2	A Phase I, Open-Label Study of the Safety and Pharmacokinetics of Escalating Doses of DSTP3086S in Patients With Metastatic Castration-Resistant Prostate Cancer
Ref 3	A Study of the Safety and Pharmacokinetics of Escalating Doses of DSTP3086S in Patients With Metastatic Castration-Resistant Prostate Cancer
Ref 4	Targeted treatment of prostate cancers and other tumors by an antibody-drug conjugate