General Information of This Antibody
Antibody ID
ANI0BWGDO
Antibody Name
Anvatabart
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Receptor tyrosine-protein kinase erbB-2 (ERBB2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSS
FSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
Anvatabart opadotin [Phase 2/3]
Identified from the Human Clinical Data
Click To Hide/Show 27 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Progression Free Survival
11.3 months
Patients Enrolled
Eligibility requires HER2-positive (IHC 3+ or 2+/FISH+) stage II-III breast cancer patients (females, 18-75 years, ECOG 0-1) with adequate organ function. Key exclusions: prior antitumor therapy, metastatic/active malignancies (last 5 years), untreated infections, severe cardiac/pulmonary diseases, pregnancy, or uncontrolled comorbidities like hypertension/diabetes.

   Click to Show/Hide
Administration Dosage
Eligible patients were randomized (1:1) to receive ARX788 (1.5 mg/kg, IV, Q3W) or lapatinib plus capecitabine (LC: lapatinib 1250 mg QD; capecitabine 1000 mg/m2 BID, days 1-14, Q3W) and stratified by prior chemotherapy lines (0-1 versus >1) and visceral metastasis (yes versus no).
Related Clinical Trial
NCT Number NCT05426486  Clinical Status PHASE2|||PHASE3
Clinical Description
A Randomized, Open Label, Multi-center Phase II-III Neoadjuvant Study Comparing the Efficacy and Safety of ARX788 Combined With Pyrotinib Maleate Versus TCBHP (Trastuzumab Plus Pertuzumab With Docetaxel and Carboplatin) in Patients With HER2-positive Breast Cancer
Primary Endpoint
The primary endpoint is total pathological complete response (tpCR) rate over 3 years, defined as no residual invasive cancer in breast and axillary lymph nodes, allowing only intraductal carcinoma.
Other Endpoint
Secondary endpoints include breast pCR (bpCR) rate, residual cancer burden (RCB) classification (0-III), best overall response rate (BORR), 5-year overall survival (OS), event-free survival (EFS), and adverse events (AEs) assessed per NCI-CTCAE v5.0, all measured within 3-5 years of follow-up.
Experiment 2 Reporting the Activity Date of This ADC [2]
Efficacy Data Objective Response Rate (ORR)
54.5
23.3 %
Patients Enrolled
Eligible subjects &ge;18 years with HER2+ metastatic breast cancer (&le;5 prior therapies including T-DXd), measurable disease per RECIST 1.1, and stable brain metastases. Key exclusions: ILD/pneumonitis history, significant cardiac/ocular conditions, uncontrolled systemic diseases, recent radiotherapy (<7 days), active COVID-19, or investigational drug use within 14 days prior. Adequate organ function and stable prior toxicity (Grade &le;1) required.

   Click to Show/Hide
Administration Dosage
Between August 2020 and June 2023, 42 pts with HER2-pos and HER2-low BC with a median of 6 prior lines of therapy received intravenous ARX788 at either 1.5, 1.6, or 1.7 mg/kg every 21 days (Q3W) or every 28 days (Q4W).
Related Clinical Trial
NCT Number NCT04829604  Clinical Status PHASE2
Clinical Description
A Global, Phase 2 Study of ARX788 in HER2-positive Metastatic Breast Cancer Patients Who Were Previously Treated With T-DXd
Primary Endpoint
Primary efficacy outcome measures Objective Response Rate (ORR) assessed per RECIST 1.1 criteria following ARX788 treatment, calculated as proportion of subjects achieving complete or partial responses within a 2-year timeframe.
Other Endpoint
Secondary endpoints include Duration of Response (DOR), Best Overall Response (BOR), Disease Control Rate (DCR), Overall Survival (OS up to 2.5 years), Progression-Free Survival (PFS), safety assessments via CTCAE v5.0, and comprehensive pharmacokinetic profiling (Cmax, Ctrough, AUC) across multiple cycles evaluating ARX788 and its components.
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
63.80%
Patients Enrolled
Eligibility requires HER2-positive (IHC 3+ or 2+/FISH+) stage II-III breast cancer patients (females, 18-75 years, ECOG 0-1) with adequate organ function. Key exclusions: prior antitumor therapy, metastatic/active malignancies (last 5 years), untreated infections, severe cardiac/pulmonary diseases, pregnancy, or uncontrolled comorbidities like hypertension/diabetes.

   Click to Show/Hide
Administration Dosage
Eligible patients were randomized (1:1) to receive ARX788 (1.5 mg/kg, IV, Q3W) or lapatinib plus capecitabine (LC: lapatinib 1250 mg QD; capecitabine 1000 mg/m2 BID, days 1-14, Q3W) and stratified by prior chemotherapy lines (0-1 versus >1) and visceral metastasis (yes versus no).
Related Clinical Trial
NCT Number NCT05426486  Clinical Status PHASE2|||PHASE3
Clinical Description
A Randomized, Open Label, Multi-center Phase II-III Neoadjuvant Study Comparing the Efficacy and Safety of ARX788 Combined With Pyrotinib Maleate Versus TCBHP (Trastuzumab Plus Pertuzumab With Docetaxel and Carboplatin) in Patients With HER2-positive Breast Cancer
Primary Endpoint
The primary endpoint is total pathological complete response (tpCR) rate over 3 years, defined as no residual invasive cancer in breast and axillary lymph nodes, allowing only intraductal carcinoma.
Other Endpoint
Secondary endpoints include breast pCR (bpCR) rate, residual cancer burden (RCB) classification (0-III), best overall response rate (BORR), 5-year overall survival (OS), event-free survival (EFS), and adverse events (AEs) assessed per NCI-CTCAE v5.0, all measured within 3-5 years of follow-up.
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Objective Response Rate (ORR)
74
69 %
Patients Enrolled
Eligible subjects are adults (&ge;18 years) with HER2-positive advanced cancers (breast, gastric, or other solid tumors) refractory to prior HER2-targeted therapies. Phase 1b requires measurable disease (RECIST v1.1), ECOG 0-1, resolved prior toxicities (&le;Grade 1), and adequate organ function. Exclusions include severe cardiac/neuropathy history, active infections (e.g., COVID-19/HIV/HBV/HCV), recent anticancer therapies (<14 days), or uncontrolled comorbidities. Contraception is mandated for participants.

   Click to Show/Hide
Administration Dosage
Experimental: ARX788 Phase 1a (Dose Escalation), ARX788 will be administered every 3 weeks (Q3W) or every 4 weeks (Q4W) via intravenous (IV) infusion. Patients will be enrolled into escalating dose levels during Dose Escalation period.Experimental: ARX788 Phase 1b (Dose Expansion), ARX788 will be administered every 3 weeks (Q3W) via intravenous (IV) infusion. Patients will receive the maximum tolerated dose during the Dose Expansion period of the study.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT03255070  Clinical Status PHASE1
Clinical Description
A Phase 1, Multicenter, Open-label, Multiple Dose-escalation and Expansion Study of ARX788, as Monotherapy in Advanced Solid Tumors With HER2 Expression
Primary Endpoint
This study evaluates ARX788's safety and immunogenicity through adverse event monitoring (Day 1 to 30 days post-treatment) and antitumor activity via RECIST v1.1-assessed objective response rates (ORR) in Phase 1b, with assessments every 6-8 weeks over 36 months.
Other Endpoint
Key efficacy outcomes include ORR (CR+PR) per RECIST v1.1 over 18 months and pharmacokinetic profiling (AUC, half-life) of ARX788 and metabolites through 36 months. Immunogenicity is tracked via anti-drug antibody development during the study.
Experiment 5 Reporting the Activity Date of This ADC [2]
Efficacy Data Disease control rate (DCR)
81.8
76.7 %
Patients Enrolled
Eligible subjects &ge;18 years with HER2+ metastatic breast cancer (&le;5 prior therapies including T-DXd), measurable disease per RECIST 1.1, and stable brain metastases. Key exclusions: ILD/pneumonitis history, significant cardiac/ocular conditions, uncontrolled systemic diseases, recent radiotherapy (<7 days), active COVID-19, or investigational drug use within 14 days prior. Adequate organ function and stable prior toxicity (Grade &le;1) required.

   Click to Show/Hide
Administration Dosage
Between August 2020 and June 2023, 42 pts with HER2-pos and HER2-low BC with a median of 6 prior lines of therapy received intravenous ARX788 at either 1.5, 1.6, or 1.7 mg/kg every 21 days (Q3W) or every 28 days (Q4W).
Related Clinical Trial
NCT Number NCT04829604  Clinical Status PHASE2
Clinical Description
A Global, Phase 2 Study of ARX788 in HER2-positive Metastatic Breast Cancer Patients Who Were Previously Treated With T-DXd
Primary Endpoint
Primary efficacy outcome measures Objective Response Rate (ORR) assessed per RECIST 1.1 criteria following ARX788 treatment, calculated as proportion of subjects achieving complete or partial responses within a 2-year timeframe.
Other Endpoint
Secondary endpoints include Duration of Response (DOR), Best Overall Response (BOR), Disease Control Rate (DCR), Overall Survival (OS up to 2.5 years), Progression-Free Survival (PFS), safety assessments via CTCAE v5.0, and comprehensive pharmacokinetic profiling (Cmax, Ctrough, AUC) across multiple cycles evaluating ARX788 and its components.
Experiment 6 Reporting the Activity Date of This ADC [3]
Efficacy Data Disease control rate (DCR)
100%
Patients Enrolled
Eligible subjects are adults (&ge;18 years) with HER2-positive advanced cancers (breast, gastric, or other solid tumors) refractory to prior HER2-targeted therapies. Phase 1b requires measurable disease (RECIST v1.1), ECOG 0-1, resolved prior toxicities (&le;Grade 1), and adequate organ function. Exclusions include severe cardiac/neuropathy history, active infections (e.g., COVID-19/HIV/HBV/HCV), recent anticancer therapies (<14 days), or uncontrolled comorbidities. Contraception is mandated for participants.

   Click to Show/Hide
Administration Dosage
Experimental: ARX788 Phase 1a (Dose Escalation), ARX788 will be administered every 3 weeks (Q3W) or every 4 weeks (Q4W) via intravenous (IV) infusion. Patients will be enrolled into escalating dose levels during Dose Escalation period.Experimental: ARX788 Phase 1b (Dose Expansion), ARX788 will be administered every 3 weeks (Q3W) via intravenous (IV) infusion. Patients will receive the maximum tolerated dose during the Dose Expansion period of the study.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT03255070  Clinical Status PHASE1
Clinical Description
A Phase 1, Multicenter, Open-label, Multiple Dose-escalation and Expansion Study of ARX788, as Monotherapy in Advanced Solid Tumors With HER2 Expression
Primary Endpoint
This study evaluates ARX788's safety and immunogenicity through adverse event monitoring (Day 1 to 30 days post-treatment) and antitumor activity via RECIST v1.1-assessed objective response rates (ORR) in Phase 1b, with assessments every 6-8 weeks over 36 months.
Other Endpoint
Key efficacy outcomes include ORR (CR+PR) per RECIST v1.1 over 18 months and pharmacokinetic profiling (AUC, half-life) of ARX788 and metabolites through 36 months. Immunogenicity is tracked via anti-drug antibody development during the study.
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Complete response (CR)
5.40%
Patients Enrolled
Eligibility requires HER2-positive (IHC 3+ or 2+/FISH+) stage II-III breast cancer patients (females, 18-75 years, ECOG 0-1) with adequate organ function. Key exclusions: prior antitumor therapy, metastatic/active malignancies (last 5 years), untreated infections, severe cardiac/pulmonary diseases, pregnancy, or uncontrolled comorbidities like hypertension/diabetes.

   Click to Show/Hide
Administration Dosage
Eligible patients were randomized (1:1) to receive ARX788 (1.5 mg/kg, IV, Q3W) or lapatinib plus capecitabine (LC: lapatinib 1250 mg QD; capecitabine 1000 mg/m2 BID, days 1-14, Q3W) and stratified by prior chemotherapy lines (0-1 versus >1) and visceral metastasis (yes versus no).
Related Clinical Trial
NCT Number NCT05426486  Clinical Status PHASE2|||PHASE3
Clinical Description
A Randomized, Open Label, Multi-center Phase II-III Neoadjuvant Study Comparing the Efficacy and Safety of ARX788 Combined With Pyrotinib Maleate Versus TCBHP (Trastuzumab Plus Pertuzumab With Docetaxel and Carboplatin) in Patients With HER2-positive Breast Cancer
Primary Endpoint
The primary endpoint is total pathological complete response (tpCR) rate over 3 years, defined as no residual invasive cancer in breast and axillary lymph nodes, allowing only intraductal carcinoma.
Other Endpoint
Secondary endpoints include breast pCR (bpCR) rate, residual cancer burden (RCB) classification (0-III), best overall response rate (BORR), 5-year overall survival (OS), event-free survival (EFS), and adverse events (AEs) assessed per NCI-CTCAE v5.0, all measured within 3-5 years of follow-up.
Experiment 8 Reporting the Activity Date of This ADC [4]
Patients Enrolled
Eligible patients are adults (18-75 years) with HR&plusmn;/HER2-low metastatic breast cancer (IHC 1+ or 2+/FISH-), prior systemic therapy exposure, measurable lesions, ECOG 0-1, and adequate organ function. Key exclusions include HER2-ADC pretreatment, active CNS metastases, uncontrolled comorbidities, interstitial lung disease, ocular disorders, recent anticancer therapies, pregnancy, or impaired trial compliance. Organ function thresholds and resolved prior toxicity (Grade &le;1) are required for enrollment.

   Click to Show/Hide
Administration Dosage
1.5 mgkg IV infusion on Day 1 of each 21-day treatment cycle.
Related Clinical Trial
NCT Number NCT05018676  Clinical Status PHASE2
Clinical Description
A Single-arm, Single-center Phase II Clinical Study of Recombinant Humanized Anti-HER2 Monoclonal Antibody-AS269 Conjugate (ARX788) in the Treatment of Unresectable and/or Metastatic Breast Cancer With Low Expression of HER2
Primary Endpoint
The primary efficacy endpoint is Objective Response Rate (ORR), defined as the proportion of subjects achieving complete or partial response per RECIST 1.1 criteria over a 2-year period.
Other Endpoint
Secondary endpoints include Progression-Free Survival (PFS), Overall Survival (OS), Disease Control Rate (DCR), and Duration of Response (DOR), all evaluated within 2 years from treatment initiation. PFS measures time from first dose to progression/death; OS tracks survival from treatment start; DCR combines ORR with stable disease cases; DOR assesses sustained response in CR/PR patients.

   Click to Show/Hide
Experiment 9 Reporting the Activity Date of This ADC [5]
Patients Enrolled
Eligibility includes HR+/HER2+ metastatic breast cancer patients (18-75 years, ECOG 0-2) with untreated brain metastases, prior trastuzumab/taxane/EGFR-TKI exposure, and adequate organ function. Key exclusions: pneumomeningeal/cystic metastases, interstitial lung disease, recent antitumor therapies (within 1-2 weeks), active infections, severe allergies, pregnancy, or uncontrolled comorbidities.

   Click to Show/Hide
Administration Dosage
1.5 mg/kg IV infusion on Day 1 of each 21-day treatment cycle.
Related Clinical Trial
NCT Number NCT05018702  Clinical Status PHASE2
Clinical Description
A Prospective, Single-arm, Single-center Phase II Clinical Study of Recombinant Humanized Anti-HER2 Monoclonal Antibody-AS269 Conjugate (ARX788) in the Treatment of HER2-positive Breast Cancer Patients With Brain Metastases
Primary Endpoint
The primary endpoint is CNS clinical benefit rate (CBR) assessed over 2 years using RANO-BM criteria, measuring the proportion of subjects achieving complete response, partial response, or stable disease.
Other Endpoint
Secondary endpoints include progression-free survival (PFS), overall survival (OS), site of first progression, and adverse event (AE) monitoring over 2 years. PFS is defined as time from first dose to progression or death, while OS tracks time to death from any cause. AEs are evaluated per NCI CTCAE v5.0 to assess treatment safety.
Experiment 10 Reporting the Activity Date of This ADC [6]
Patients Enrolled
Eligible participants include adults (&ge;18 years, ECOG 0-2) with HER2-low (IHC 1+/2+/FISH-) unresectable/metastatic breast cancer (HR+ or HR- cohorts), measurable lesions by RECIST 1.1, and controlled brain metastases if treated. Key exclusions: prior ARX-788/auristatin exposure, active ILD/pneumonitis, uncontrolled cardiac/pulmonary conditions, QTc prolongation (>450-470 ms), ocular diseases (keratitis), pregnancy, or malignancies requiring treatment within 3 years (exceptions: cured skin/thyroid cancers).

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06224673  Clinical Status PHASE2
Clinical Description
Phase II Open-label Study of ARX788 (Anti-HER2 Antibody Drug Conjugate (ADC)) for Patients With HER2-low Locally Advanced Unresectable or Metastatic Breast Cancer
Primary Endpoint
The primary endpoint is objective response rate (ORR) evaluated over 1 year using RECIST 1.1 criteria, reporting the proportion of participants achieving complete or partial response with 90% confidence intervals.
Other Endpoint
Secondary objectives include duration of response (DOR), best overall response (BOR), disease control rate (DCR), median progression-free survival (PFS), median overall survival (OS), treatment-emergent AEs, ocular AE monitoring with visual/keratitis assessments, and adherence to preventive eye drop regimen - all analyzed within 1-2 years with 95% CIs where applicable.

   Click to Show/Hide
Experiment 11 Reporting the Activity Date of This ADC [7]
Patients Enrolled
Eligible patients are 18-75 years old with HER2+ unresectable BC, prior T-DXd treatment, and adequate organ function. Exclusions include CNS metastases, interstitial lung disease, active eye infections, cardiac insufficiency, or recent systemic therapy (except endocrine therapy within 28 days).
Administration Dosage
ARX788,1.5 mg/kg IV infusion on Day 1 of each 21-day treatment cycle
Related Clinical Trial
NCT Number NCT06578286  Clinical Status PHASE2
Clinical Description
Evaluate the Efficacy and Safety of ARX788 in Patients With HER2-positive Advanced Breast Cancer Whose Disease Has Progressed Following T-DXd Therapy
Primary Endpoint
The primary endpoint is objective remission rate (ORR), measured by CR or PR per RECIST 1.1, assessed up to 24 months.
Other Endpoint
Secondary endpoints include disease control rate (DCR) (CR, PR, or SD), duration of relief (DOR), progression-free survival (PFS), overall survival (OS), and adverse events (TEAEs), monitored per RECIST 1.1 and CTCAE v5.0, assessed up to 50 months.
Experiment 12 Reporting the Activity Date of This ADC [8]
Patients Enrolled
Exclusion criteria encompass known ARX788 hypersensitivity, active CNS metastases requiring treatment, symptomatic effusions requiring intervention, significant pulmonary/cardiac/ophthalmic comorbidities, uncontrolled hypertension, recent live vaccinations, pregnancy/breastfeeding, recent antitumor therapy (<28 days), cognitive impairments affecting consent comprehension, and any investigator-assessed conditions potentially compromising patient safety or protocol compliance.

   Click to Show/Hide
Administration Dosage
2.2 mg/kg IV infusion on Day 1 of each 42-day treatment cycle.
Related Clinical Trial
NCT Number NCT06663748  Clinical Status PHASE2
Clinical Description
Evaluate the Efficacy and Safety of ARX788 Given Every 6 Weeks in Patients with HER2-positive Advanced Breast Cancer
Primary Endpoint
The study evaluates key efficacy parameters including objective response rate (ORR) based on RECIST 1.1, disease control rate (DCR), duration of response (DOR), progression-free survival (PFS), overall survival (OS), and incidence of treatment-emergent adverse events (TEAEs) assessed by CTCAE v5.0. Pharmacokinetic parameters such as Cmax, tmax, t1/2, AUC (0-inf), AUC (0-last), λz, CL, Vz, Vss, and Ctrough are measured at specified cycle endpoints to characterize drug exposure and metabolism.

   Click to Show/Hide
Other Endpoint
Eligible participants aged 18-75 with HER2-positive (IHC3+ or FISH+) unresectable locally advanced, recurrent, or metastatic breast cancer who have received ≤2 prior chemotherapy lines (excluding hormonal therapy) and have ≥1 measurable lesion per RECIST1.1. Required criteria include recovery from prior treatment toxicities (≤Grade 1), adequate organ function, ECOG 0-1, and willingness to comply with study procedures and contraception requirements.

   Click to Show/Hide
Experiment 13 Reporting the Activity Date of This ADC [9]
Patients Enrolled
Eligible subjects must have life expectancy >12 weeks, BMI 18-32 kg/m2, HER2-positive advanced cancer with prior HER2-targeted therapy (where applicable), measurable disease per RECIST v1.1 (Phase 1b), and adequate organ function. Exclusions include severe allergies, uncontrolled CNS metastases, heart conditions, neuropathy, electrolyte imbalances, recent anticancer therapy/surgery/radiation, pregnancy, or inability to consent.

   Click to Show/Hide
Administration Dosage
Six cohorts with escalated dose levels of ARX788 at 0.33 mg/kg, 0.66 mg/kg, 1.3 mg/kg, 2.2 mg/kg, 2.9 mg/kg and 3.8 mg/kg will be administered every 3 weeks via intravenous infusion to determine the MTD.
Related Clinical Trial
NCT Number NCT02512237  Clinical Status PHASE1
Clinical Description
A Phase 1, Multicenter, Open-label, Multiple Dose-escalation Study of ARX788, Intravenously Administered as a Single Agent in Subjects With Advanced Cancers With HER2 Expression
Primary Endpoint
The study aims to determine the maximum tolerated dose of ARX788 over 12 months, identifying the highest dose where fewer than 2 of 6 subjects experience dose-limiting toxicity.
Other Endpoint
Safety and tolerability of ARX788 will be assessed over 30 months through adverse events, lab tests, and vital signs. Pharmacokinetic properties (AUC, half-life) will be measured after infusion cycles 1 and 3. Tumor response and immunogenicity (anti-ARX788 antibodies) will be evaluated over 18-30 months.
Experiment 14 Reporting the Activity Date of This ADC [10]
Patients Enrolled
Eligible patients have untreated, measurable (&ge;2.5cm) stage II-III breast cancer with biomarker profiles matching study arms. Key requirements include adequate organ function, no distant metastases, and compatible MRI eligibility. Exclusions involve prior chemotherapy/radiation for current malignancy, uncontrolled comorbidities, or investigational drug use within 30 days.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT01042379  Clinical Status PHASE2
Clinical Description
I-SPY Trial (Investigation of Serial Studies to Predict Your Therapeutic Response With Imaging And moLecular Analysis 2)
Primary Endpoint
This study evaluates whether adding experimental agents to standard neoadjuvant therapy improves pathologic complete response (pCR) rates within biomarker-defined subgroups, assessed post-surgery after up to 36 weeks of treatment.
Other Endpoint
The trial examines predictive biomarkers for pCR and residual cancer burden through serial blood/tissue collections. Secondary objectives include 3/5-year survival outcomes, safety profiling of investigational agents, and tumor volume changes via MRI at four timepoints during treatment and follow-up.
Experiment 15 Reporting the Activity Date of This ADC [11]
Patients Enrolled
Exclusion criteria include prior interstitial lung disease or pneumonitis within 12 months, ongoing ocular conditions, recent anticancer therapy or radiotherapy, and significant surgeries within 21 days. Breast/gastric cancers are excluded from Cohort 4, and additional eligibility is determined by the study center.
Administration Dosage
ARX788 will be administered by intravenous (IV) infusion every 3 weeks (Q3W).
Related Clinical Trial
NCT Number NCT05041972  Clinical Status PHASE2
Clinical Description
A Global Phase 2 Study to Evaluate the Efficacy and Safety of ARX788 for Selected HER2-mutated or HER2-amplified/Overexpressed Solid Tumors
Primary Endpoint
The primary endpoint is Objective Response Rate (ORR) assessed by BICR per RECIST 1.1, defined as the proportion of subjects achieving CR or PR. Secondary endpoints include Duration of Response (DOR), Best Overall Response (BOR), Disease Control Rate (DCR), Progression-Free Survival (PFS), Overall Survival (OS), Time to Response (TTR), pharmacokinetic parameters (Cmax and Ctrough for ARX788, total antibody, and metabolites), and incidence of anti-drug antibodies (ADAs).

   Click to Show/Hide
Other Endpoint
Eligibility criteria include age ≥18, life expectancy >3 months, ECOG ≤1, and HER2 status confirmed via CLIA-certified lab. Cohorts 1, 2, and A require HER2 mutations in NSCLC, breast cancer, or other tumors without prior HER2 ADC treatment. Cohorts 3-5 include HER2-amplified BTC, CRC, ovarian, endometrial, NSCLC, and other tumors, with Cohort 5 allowing prior HER2 ADC. Subjects must have stable brain metastases and adequate organ function.

   Click to Show/Hide
Experiment 16 Reporting the Activity Date of This ADC [12]
Efficacy Data Objective Response Rate (ORR)
57.10%
Patients Enrolled
Patients with HER2+ mBC whose disease has progressed following T-DM1, T-DXd, and/or tucatinib-containing regimens.
Administration Dosage
Administered with an initial dose of 1.50 mg/kg Q4W and subsequent doses of 1.30 mg/kg Q4W.
Related Clinical Trial
NCT Number NCT04829604  Clinical Status Phase 2
Clinical Description
A global, phase 2 study of ARX788 in HER2-positive metastatic breast cancer patients who were previously treated with T-DXd.
Experiment 17 Reporting the Activity Date of This ADC [13]
Efficacy Data Objective Response Rate (ORR)
33.30
46.20
28.60 %
Patients Enrolled
Twenty-two (73.30%) had gastric adenocarcinoma, and the rest (26.70%) had GEJ adenocarcinoma.
Administration Dosage
At least one dose of ARX788, of whom 9 patients received 1.30 mg/kg, 14 received 1.50 mg/kg, and 7 received 1.70 mg/kg ARX788. The median treatment duration was 3.5 (range: 1-29) cycles.
Related Clinical Trial
NCT Number CTR20171162  Clinical Status Phase 1
Clinical Description
A phase 1 study of ACE-Breast-01 [ZMC-ARX788111 (CTR20171162)] to test the safety, PK, and antitumor activity of ARX788 in patients in China with HER2-positive metastatic breast cancer (MBC) whose disease had progressed on prior anti-HER2 treatments. The study includes dose escalation(N=69) to determine the maximum tolerated dose (MTD)/recommended phase 2 dose (RP2D) in patients with HER2-positive MBC.

   Click to Show/Hide
Primary Endpoint
The MTD of ARX788 was not reached at doses of up to 1.50 mg/kg every 3 weeks. the RP2D in breast cancer studies was determined to be 1.50 mg/kg every 3 weeks. 33 of the 69 (47.83%) patients had an objective partial tumor response. For ARX788 1.50 mg/kg every 3 weeks, the objective response rate was 65.52% [19/29, 95% confidence interval (CI), 45.70-82.10], the disease control rate was 100.00% (95% CI, 81.20-100.00), and the median progression-free survival was 17.02 months (95% CI, 10.09-not reached).

   Click to Show/Hide
Experiment 18 Reporting the Activity Date of This ADC [13]
Efficacy Data Objective Response Rate (ORR)
37.90%
Patients Enrolled
HER2-positive advanced gastric/gastroesophageal junction adenocarcinoma failing to respond to prior trastuzumab-based standard treatment, at least one dose.
Administration Dosage
9 patients received 1.30 mg/kg, 14 received 1.50 mg/kg, and 7 received 1.70 mg/kg ARX788.
Related Clinical Trial
NCT Number CTR20171162  Clinical Status Phase 1
Clinical Description
A phase 1 study in HER2-positive advanced ug/GEJ adenocarcinoma was initiated to evaluate the safety and efficacy of ARX788. There were 22 males (73.3%) and 8 females (26.7%). Twenty-two (73.3%) had gastric adenocarcinoma,and the rest (26.7%) had GEJ adenocarcinoma. Twenty-seven patients (90%) underwent prior trastuzumab-containing therapy,eight of whom progressed within 6 months in the adjuvant or neoadjuvant phase. Twelve (40%) were treated with 2 or more lines of therapy (26) and eight of whom had 3 or more lines. All patients were treated with platinum-based and fluorouracil regimens,and eight with taxanes and three with irinotecan. Most participants (73.3%) had an Eastern Cooperative Oncology Group (ECOG) performance status (PS) of 1. All of them had at least one dose of ARX788,of whom 9 patients received 1.3 mg/kg,14 received 1.5 mg/kg,and 7 received 1.7 mg/kg ARX788.

   Click to Show/Hide
Primary Endpoint
For ARX788 1.70 mg/kg, a median follow up of 10 (95% CI: 6.50-15.90) months,the median PFS was 4.10 (95% CI,1.40-6.40) months,and the median OS was 10.70 (95% CI,4.80-not reached) months.
Experiment 19 Reporting the Activity Date of This ADC [14]
Efficacy Data Objective Response Rate (ORR)
65.52%
Patients Enrolled
Incurable, locally advanced, or metastatic HER2-positive (immunohistochemistry [IHC] 3+ and/or fluorescence in situ 1 hybridization [FISH]-positive) breast cancer that progressed on greater and or 2 equal to two prior anti-HER2 treatment(s) in the advanced disease setting and 3 who provided written informed consent, patients had an Eastern 4 Cooperative Oncology Group (ECOG) performance status of 0-1.

   Click to Show/Hide
Administration Dosage
0.33 mg/kg Q3W, 0.66 mg/kg Q3W, 0.88 mg/kg Q4W, 0.88 mg/kg Q3W, 1.10 mg/kg Q4W, 1.10 mg/kg Q3W, 1.30 mg/kg Q4W, 1.30 mg/kg Q3W, and 1.50 mg/kg Q3W, intravenous infusion.
Related Clinical Trial
NCT Number CTR20171162  Clinical Status Phase 1
Clinical Description
Patients with HER2-positive MBC received ARX788 at doses of 0.33, 0.66, 0.88, 1.10, 1.30, or 1.50 mg/kg every 3 weeks, or 0.88, 1.10, or 1.30 mg/kg every 4 weeks. The dose-limiting toxicity (DLT) was assessed for 84 days for pulmonary toxicity and at a duration of one cycle (21 or 28 days) for other toxicities. In total, 69 patients were enrolled. No DLT or drug-related deaths occurred.

   Click to Show/Hide
Primary Endpoint
At 1.50 mg/kg every 3 weeks, the recommended phase II dose, the objective response rate was 65.52% [19/29, 95% confidence interval (CI), 45.70-82.10].
Other Endpoint
The disease control rate was 100.00% (95% CI, 81.20-100.00), and the median progression-free survival was 17.02 months (95% CI, 10.09-not reached).
Experiment 20 Reporting the Activity Date of This ADC [15]
Efficacy Data Objective Response Rate (ORR)
74.00
67.00 %
Patients Enrolled
ACE-Breast-01 (median 6 prior lines of therapy) and ACE-Pan tumor-01 trial (including breast, gastric/GEJ, NSCLC, ovarian, urothelial, biliary track, endometrial, and salivary gland cancer).
Administration Dosage
0.33 - 1.5 mg/kg; Q3W or Q4W.
Related Clinical Trial
NCT Number NCT03255070  Clinical Status Phase 1
Clinical Description
A phase 1, multicenter, open-label, multiple dose-escalation and expansion study of ARX788, as monotherapy in advanced solid tumors with HER2 expression.
Experiment 21 Reporting the Activity Date of This ADC [16]
Related Clinical Trial
NCT Number NCT05426486  Clinical Status Phase 2/3
Clinical Description
A randomized, open label, multi-center phase 2-2i neoadjuvant study comparing the efficacy and safety of ARX788 combined with pyrotinib maleate versus TCBHP (trastuzumab plus pertuzumab with docetaxel and carboplatin) in patients with HER2-positive breast cancer.
Experiment 22 Reporting the Activity Date of This ADC [17]
Related Clinical Trial
NCT Number NCT01042379  Clinical Status Phase 2
Clinical Description
I-SPY trial (investigation of serial studies to predict your therapeutic response with imaging and molecular analysis 2).
Experiment 23 Reporting the Activity Date of This ADC [18]
Related Clinical Trial
NCT Number NCT04983121  Clinical Status Phase 2
Clinical Description
Efficacy and safety of pyrotinib maleate combined with ARX788 neoadjuvant treatment in stage 2-2I HER2-positive breast cancer patients who have poor outcomes after treatment with trastuzumab and pertuzumab.
Experiment 24 Reporting the Activity Date of This ADC [19]
Related Clinical Trial
NCT Number NCT05018702  Clinical Status Phase 2
Clinical Description
A prospective, single-arm, single-center phase 2 clinical study of recombinant humanized anti-HER2 monoclonal antibody-AS269 conjugate (ARX788) in the treatment of HER2-positive breast cancer patients with brain metastases.
Experiment 25 Reporting the Activity Date of This ADC [20]
Related Clinical Trial
NCT Number NCT05018676  Clinical Status Phase 2
Clinical Description
A single-arm, single-center phase 2 clinical study of recombinant humanized anti-HER2 monoclonal antibody-AS269 conjugate (ARX788) in the treatment of unresectable and/or metastatic breast cancer with low expression of HER2.
Experiment 26 Reporting the Activity Date of This ADC [21]
Related Clinical Trial
NCT Number NCT05041972  Clinical Status Phase 2
Clinical Description
A global phase 2 study to evaluate the efficacy and safety of ARX788 for selected HER2-mutated or HER2-amplified/overexpressed solid tumors.
Experiment 27 Reporting the Activity Date of This ADC [22]
Related Clinical Trial
NCT Number NCT02512237  Clinical Status Phase 1
Clinical Description
A phase 1, multicenter, open-label, multiple dose-escalation study of ARX788, intravenously administered as a single agent in subjects with advanced cancers with HER2 expression.
References
Ref 1 A Study of ARX788 Combined With Pyrotinib Maleate Versus TCBHP (Trastuzumab Plus Pertuzumab With Docetaxel and Carboplatin) as Neoadjuvant Treatment in HER2-positive Breast Cancer Patients
Ref 2 ARX788 in HER2-positive, Metastatic Breast Cancer Subjects (ACE-Breast-03)
Ref 3 Safety and unique pharmacokinetic profile of ARX788, a site-specific ADC, in heavily pretreated patients with HER2-overexpresing solid tumors: Results from two phase 1 clinical trials
Ref 4 ARX788 in Breast Cancer With Low Expression of HER2
Ref 5 ARX788 in HER2-positive Breast Cancer Patients With Brain Metastases
Ref 6 ARX788 for Treating Patients With HER2-low Locally Advanced Unresectable or Metastatic Breast Cancer
Ref 7 ARX788 in HER2-positive Metastatic Breast Cancer Patients Who Were Previously Treated With T-DXd
Ref 8 ARX788 in HER2-positive Metastatic Breast Cancer Patients
Ref 9 A Dose-escalation Study of ARX788, IV Administered in Subjects With Advanced Cancers With HER2 Expression
Ref 10 I-SPY TRIAL: Neoadjuvant and Personalized Adaptive Novel Agents to Treat Breast Cancer
Ref 11 ARX788 in Selected HER2-mutated or HER2-amplified/Overexpressed Solid Tumors (ACE-Pan Tumor-02)
Ref 12 ACE-Breast-03: Efficacy and safety of ARX788 in patients with HER2+ metastatic breast cancer previously treated with T-DM1. Cancer Res (2023) 83 (5_Supplement): PD18-09.
Ref 13 Phase 1 multicenter, dose-expansion study of ARX788 as monotherapy in HER2-positive advanced gastric and gastroesophageal junction adenocarcinoma. Cell Rep Med. 2022 Nov 15;3(11):100814.
Ref 14 Phase I Trial of a Novel Anti-HER2 Antibody-Drug Conjugate, ARX788, for the Treatment of HER2-Positive Metastatic Breast Cancer. Clin Cancer Res. 2022 Jun 29:OF1-OF10.
Ref 15 Safety and unique pharmacokinetic profile of ARX788, a site-specific ADC, in heavily pretreated patients with HER2-overexpresing solid tumors: Results from two phase 1 clinical trials. J Clin Oncol. 2021 39:15_suppl, 1038-1038.
Ref 16 A Randomized, Open Label, Multi-center Phase II-III Neoadjuvant Study Comparing the Efficacy and Safety of ARX788 Combined With Pyrotinib Maleate Versus TCBHP (Trastuzumab Plus Pertuzumab With Docetaxel and Carboplatin) in Patients With HER2-positive Breast Cancer, NCT05426486
Ref 17 I-SPY Trial (Investigation of Serial Studies to Predict Your Therapeutic Response With Imaging And moLecular Analysis 2), NCT01042379
Ref 18 Efficacy and Safety of Pyrotinib Maleate Combined With ARX788 Neoadjuvant Treatment in Stage II-III HER2-positive Breast Cancer Patients Who Have Poor Outcomes After Treatment With Trastuzumab and Pertuzumab, NCT04983121
Ref 19 A Prospective, Single-arm, Single-center Phase II Clinical Study of Recombinant Humanized Anti-HER2 Monoclonal Antibody-AS269 Conjugate (ARX788) in the Treatment of HER2-positive Breast Cancer Patients With Brain Metastases, NCT05018702
Ref 20 A Single-arm, Single-center Phase II Clinical Study of Recombinant Humanized Anti-HER2 Monoclonal Antibody-AS269 Conjugate (ARX788) in the Treatment of Unresectable and/or Metastatic Breast Cancer With Low Expression of HER2, NCT05018676
Ref 21 A Global Phase 2 Study to Evaluate the Efficacy and Safety of ARX788 for Selected HER2-mutated or HER2-amplified/Overexpressed Solid Tumors, NCT05041972
Ref 22 A Phase 1, Multicenter, Open-label, Multiple Dose-escalation Study of ARX788, Intravenously Administered as a Single Agent in Subjects With Advanced Cancers With HER2 Expression, NCT02512237