Antibody Information

General Information of This Antibody
Antibody ID
ANI0ABINN
Antibody Name
MAB100
Synonyms
UCHT1
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Chimeric IgG1-kappa
Antigen Name
Epidermal growth factor receptor (EGFR)
  Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPS
RFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
    Click to Show/Hide
Light Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYN
TPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYADYEFAYWGQGTLVTVSA
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
AVID100 [Phase 1/2 (discontinued)]
 ADC Info 
Identified from the Human Clinical Data
Click To Hide/Show 2 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Patients Enrolled
Inclusion criteria for Phase 1 involve patients with advanced/metastatic solid tumors refractory to standard therapy or ineligible for surgery, while Phase 2a targets specific EGFR-overexpressing cancers. Exclusion criteria for both phases include pregnancy, uncontrolled CNS metastases, significant comorbidities, and recent malignancies. Prohibited treatments encompass recent antineoplastic therapies, investigational drugs, radiotherapy, immunosuppressants, and strong CYP3A4 modifiers.

   Click to Show/Hide
Administration Dosage
No cycle 1 dose limiting toxicities (DLTs) have been observed in Cohorts 1-6 (dose (N); 20 (1), 40 (1), 80 (3), 120 (3), 180 (3), and 220 (3) mg/m2 every 3 weeks). Currently, patients are being evaluated in Cohort 7 (270 mg/m2; approximately 6.9 mg/kg).
Related Clinical Trial
NCT Number NCT03094169  Clinical Status PHASE1|||PHASE2
Clinical Description
Phase 1a/2a Dose Escalation Trial to Determine Safety, Tolerance, MTD, and Preliminary Antineoplastic Activity of AVID100, in Patients With Advanced or Metastatic Solid Tumors of Epithelial Origin
Primary Endpoint
The primary objectives include assessing the safety and tolerability of AVID100 in Phase 1a, focusing on abnormal lab values and adverse events, while Phase 2a evaluates preliminary antineoplastic effects based on objective response or stable disease.
Other Endpoint
The PK profile of total antibody will be characterized over an 18-month period to understand its pharmacokinetic behavior.
Experiment 2 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Patients with advanced or metastatic epithelial malignancies.
Administration Dosage
20, 40, 80, 120, 180, and 220 mg/m2 every 3 weeks.
Related Clinical Trial
NCT Number NCT03094169  Clinical Status Phase 1/2
Clinical Description
Phase 1a/2a dose escalation trial to determine safety, tolerance, MTD, and preliminary antineoplastic activity of AVID100, in patients with advanced or metastatic solid tumors of epithelial origin.
References
Ref 1 AVID100 in Advanced Epithelial Carcinomas
Ref 2 First-in-human study of the B7-H4 antibody-drug conjugate (ADC) AZD8205 in patients with advanced/metastatic solid tumors. J Clin Oncol. 2022 40:16_suppl, TPS3153-TPS3153.