Antigen Information
General Information of This Antigen
Antigen ID | TAR0XYHYS |
|||||
---|---|---|---|---|---|---|
Antigen Name | Integrin alpha-10 (ITGA10) |
|||||
Gene Name | ITGA10 |
|||||
Gene ID | ||||||
Sequence |
MELPFVTHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHVGGGQRWMLVGA
PWDGPSGDRRGDVYRCPVGGAHNAPCAKGHLGDYQLGNSSHPAVNMHLGMSLLETDGDGG FMACAPLWSRACGSSVFSSGICARVDASFQPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP WSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSRREG RETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY GIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS HAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHRLFPPRMALEDEF PPALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGE QIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ PEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQRIA AASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLTPSLEVTPQAIS VVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDHQFYMRFTASLDEWTAGARAAFDGSGQ RLSPRRLRLSVGNVTCEQLHFHVLDTSDYLRPVALTVTFALDNTTKPGPVLNEGSPTSIQ KLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKVLVSTTLENRKENAYNT SLSLIFSRNLHLASLTPQRESPIKVECAAPSAHARLCSVGHPVFQTGAKVTFLLEFEFSC SSLLSQVFVKLTASSDSLERNGTLQDNTAQTSAYIQYEPHLLFSSESTLHRYEVHPYGTL PVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCIVQNLT EPPGPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRAKFK SLTVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLLALL VFCLWKLGFFAHKKIPEEEKREEKLEQ Click to Show/Hide
|
|||||
Family | TIM family |
|||||
Function |
Integrin alpha-10/beta-1 is a receptor for collagen.
Click to Show/Hide
|
|||||
Uniprot Entry | ||||||
HGNC ID | ||||||
KEGG ID |
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-integrin alpha10 mAb
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
Anti-alpha10-SAP |
Saporin |
Microtubule (MT) |
Undisclosed |
[1] |
Undisclosed
ADC Info | ADC Name | Payload | Target | Linker | Ref |
---|---|---|---|---|---|
Antibody-drug conjugate (Xintela) |
Undisclosed |
Undisclosed |
Undisclosed |
[2] | |
TARG-9 |
Undisclosed |
Undisclosed |
Undisclosed |
[3] | |
TARG-10 |
Undisclosed |
Undisclosed |
Undisclosed |
[4] |
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Bacterial infection of gingival | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.16E-05; Fold-change: 0.226850018; Z-score: 0.734539598 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 02
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Brainstem | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.006407754; Fold-change: -0.237627754; Z-score: -6.197152613 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | White matter | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.550070673; Fold-change: 0.098554893; Z-score: 0.129941964 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Brainstem | |
The Specific Disease | Neuroectodermal tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003082939; Fold-change: -0.569860448; Z-score: -1.869146035 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Nervous | |
The Specific Disease | Brain cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.18E-05; Fold-change: 0.1230286; Z-score: 0.24817029 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Polycythemia vera | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.44E-09; Fold-change: -0.101745485; Z-score: -1.110054007 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Whole blood | |
The Specific Disease | Myelofibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.059432448; Fold-change: -0.019981551; Z-score: -0.238045769 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myelodysplastic syndromes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.459114165; Fold-change: -0.011339168; Z-score: -0.03426507 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.510439616; Fold-change: -0.079565248; Z-score: -0.511373159 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Tonsil | |
The Specific Disease | Lymphoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.170792714; Fold-change: 0.148221518; Z-score: 0.502424309 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric | |
The Specific Disease | Gastric cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.32230807; Fold-change: -0.003281848; Z-score: -0.01272369 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.014108071; Fold-change: -0.11619365; Z-score: -0.421704993 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon | |
The Specific Disease | Colon cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.005170821; Fold-change: -0.045365583; Z-score: -0.18846754 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.007612968; Fold-change: -0.061101963; Z-score: -0.21850146 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pancreas | |
The Specific Disease | Pancreatic cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.462804206; Fold-change: -0.110045417; Z-score: -0.288197815 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.12E-05; Fold-change: 0.189417863; Z-score: 0.639463985 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.417841735; Fold-change: -0.099522838; Z-score: -0.357059842 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.02E-05; Fold-change: -0.156354003; Z-score: -0.550326292 | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.637816804; Fold-change: -0.123959251; Z-score: -0.516011979 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Lung cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.21E-27; Fold-change: -0.623888209; Z-score: -1.125709565 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.43E-35; Fold-change: -1.141511533; Z-score: -2.007442874 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Melanoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002006894; Fold-change: -0.167134909; Z-score: -0.302017002 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Sarcoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.58E-25; Fold-change: 0.266250227; Z-score: 0.892821229 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.009322119; Fold-change: 0.148367373; Z-score: 0.613110121 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Breast | |
The Specific Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.89E-09; Fold-change: -0.291439599; Z-score: -0.504254279 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 7.82E-06; Fold-change: -0.399702009; Z-score: -0.673147084 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Ovarian | |
The Specific Disease | Ovarian cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.279121949; Fold-change: -0.115390868; Z-score: -0.405147101 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.009936757; Fold-change: 0.178776132; Z-score: 0.598976278 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Cervical | |
The Specific Disease | Cervical cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.93E-05; Fold-change: -0.324175047; Z-score: -1.233566837 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Uterine cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001236202; Fold-change: -0.103059151; Z-score: -0.214261847 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.115599959; Fold-change: -0.515766188; Z-score: -0.513694403 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Prostate | |
The Specific Disease | Prostate cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001146583; Fold-change: -0.611188904; Z-score: -0.904451627 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Bladder cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.038343608; Fold-change: 0.217038872; Z-score: 0.839484253 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Uvea | |
The Specific Disease | Retinoblastoma tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.013128208; Fold-change: -0.510800332; Z-score: -2.249252643 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Thyroid | |
The Specific Disease | Thyroid cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.09E-05; Fold-change: 0.100254187; Z-score: 0.375709863 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.140517634; Fold-change: -0.155387683; Z-score: -0.52680587 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adrenal cortex | |
The Specific Disease | Adrenocortical carcinoma | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.183684163; Fold-change: -0.068641774; Z-score: -0.228148744 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Head and neck | |
The Specific Disease | Head and neck cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.743174388; Fold-change: 0.016434535; Z-score: 0.052231448 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary gonadotrope tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.071662182; Fold-change: -0.436519351; Z-score: -0.478293446 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.076750021; Fold-change: -0.324719044; Z-score: -0.421657983 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 03
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocytopenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.414988543; Fold-change: 0.205573546; Z-score: 0.350269382 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 04
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Lupus erythematosus | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.13E-05; Fold-change: -0.074226333; Z-score: -0.215204396 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral monocyte | |
The Specific Disease | Autoimmune uveitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.992523854; Fold-change: 0.077445892; Z-score: 0.329797253 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 05
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Familial hypercholesterolemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.103226147; Fold-change: 0.039932406; Z-score: 0.188933649 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 06
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Superior temporal cortex | |
The Specific Disease | Schizophrenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.54239453; Fold-change: 0.028990611; Z-score: 0.17989387 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 08
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Spinal cord | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.051129403; Fold-change: -0.339874081; Z-score: -1.225767834 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Plasmacytoid dendritic cells | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.34489869; Fold-change: -0.062189395; Z-score: -0.106251618 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peritumoral cortex | |
The Specific Disease | Epilepsy | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.800648297; Fold-change: 0.244093324; Z-score: 0.495977355 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Cardioembolic Stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.581006321; Fold-change: 0.229916744; Z-score: 0.493490316 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Ischemic stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.993163594; Fold-change: -0.06413973; Z-score: -0.366765724 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 1
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | White matter | |
The Specific Disease | HIV | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.371926923; Fold-change: -0.044128468; Z-score: -0.148894259 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Influenza | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011986615; Fold-change: 0.38204156; Z-score: 3.333408222 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Chronic hepatitis C | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.602355513; Fold-change: 0.025582588; Z-score: 0.164346044 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Sepsis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.401972536; Fold-change: 0.012267661; Z-score: 0.054276899 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Septic shock | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000797292; Fold-change: 0.068132575; Z-score: 0.338401013 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Pediatric respiratory syncytial virus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.500508144; Fold-change: 0.026240895; Z-score: 0.162496902 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 11
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Essential hypertension | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.476965418; Fold-change: 0.300842439; Z-score: 1.174484332 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myocardial infarction | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.283747193; Fold-change: 0.099654589; Z-score: 0.177775021 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Coronary artery disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.622968337; Fold-change: -0.09253708; Z-score: -0.270303406 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Calcified aortic valve | |
The Specific Disease | Aortic stenosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.207951798; Fold-change: -1.215259629; Z-score: -1.002364332 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arteriosclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.190011527; Fold-change: 0.115139561; Z-score: 0.927346626 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Intracranial artery | |
The Specific Disease | Aneurysm | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000250776; Fold-change: 1.610152996; Z-score: 2.807721073 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 12
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Immunodeficiency | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.126944272; Fold-change: -0.102159707; Z-score: -1.153764454 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Hyperplastic tonsil | |
The Specific Disease | Apnea | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.306141202; Fold-change: -0.069551177; Z-score: -0.364226447 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Olive pollen allergy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.812444791; Fold-change: 0.030650617; Z-score: 0.162067992 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Sinus mucosa | |
The Specific Disease | Chronic rhinosinusitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.878984509; Fold-change: 0.01868142; Z-score: 0.025844105 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.893661358; Fold-change: -0.007771429; Z-score: -0.015282152 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Small airway epithelium | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.533348383; Fold-change: 0.004826979; Z-score: 0.021248894 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal and bronchial airway | |
The Specific Disease | Asthma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.95E-05; Fold-change: 0.187705697; Z-score: 0.396430036 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal Epithelium | |
The Specific Disease | Human rhinovirus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.703815147; Fold-change: -0.019022837; Z-score: -0.170559332 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Idiopathic pulmonary fibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002282217; Fold-change: -1.270739659; Z-score: -2.484135651 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 13
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Periodontal disease | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.04E-05; Fold-change: 0.177788155; Z-score: 0.60661751 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric antrum | |
The Specific Disease | Eosinophilic gastritis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.243248818; Fold-change: 0.285602766; Z-score: 1.592207904 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver failure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.292691776; Fold-change: 0.124213143; Z-score: 0.376534514 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon mucosal | |
The Specific Disease | Ulcerative colitis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.50121258; Fold-change: -0.083068418; Z-score: -0.323784746 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Irritable bowel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.259820222; Fold-change: -0.053846719; Z-score: -0.162112163 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 14
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Atopic dermatitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.08E-06; Fold-change: 0.221921792; Z-score: 1.235931705 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Psoriasis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.40E-05; Fold-change: 0.143560622; Z-score: 0.398853586 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 6.70E-05; Fold-change: -0.309255988; Z-score: -0.529983303 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Vitiligo | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.587675202; Fold-change: -0.062442395; Z-score: -0.122305919 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin from scalp | |
The Specific Disease | Alopecia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.044471919; Fold-change: 0.197080941; Z-score: 0.547476716 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Sensitive skin | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.967926948; Fold-change: -0.121836962; Z-score: -0.473456026 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 15
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Osteoarthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.40011845; Fold-change: 1.205853886; Z-score: 0.758242481 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthropathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.05613131; Fold-change: -0.15422553; Z-score: -1.012982882 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011243005; Fold-change: -0.257566272; Z-score: -0.742609654 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Rheumatoid arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003526258; Fold-change: 0.714867134; Z-score: 1.577191326 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pheripheral blood | |
The Specific Disease | Ankylosing spondylitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.495951865; Fold-change: -0.022357987; Z-score: -0.216899296 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Osteoporosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.049612757; Fold-change: -0.482082404; Z-score: -1.061946814 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 16
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Endometriosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.104171487; Fold-change: -0.112887116; Z-score: -0.230756335 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Interstitial cystitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.012065892; Fold-change: 0.333858444; Z-score: 2.498865029 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 19
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Myometrium | |
The Specific Disease | Preterm birth | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.307410142; Fold-change: -0.05503299; Z-score: -0.283879908 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 2
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Acute myelocytic leukemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.908197807; Fold-change: -0.003529602; Z-score: -0.017217257 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002858747; Fold-change: -0.287386067; Z-score: -1.681790873 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.3682548; Fold-change: 0.070794658; Z-score: 0.327356014 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Oral | |
The Specific Disease | Oral cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.17725494; Fold-change: -0.009833172; Z-score: -0.031079831 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.07112697; Fold-change: -0.118371802; Z-score: -0.386245405 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Esophagus | |
The Specific Disease | Esophagal cancer | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.003146875; Fold-change: -0.290494316; Z-score: -2.330290705 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Rectal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.514224907; Fold-change: 0.095137555; Z-score: 0.547406344 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.383767243; Fold-change: 7.44E-05; Z-score: 0.000642523 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Skin cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.87E-27; Fold-change: 0.470051458; Z-score: 1.18525943 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.92E-12; Fold-change: 0.105030445; Z-score: 0.180851388 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Kidney | |
The Specific Disease | Renal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.596803596; Fold-change: 0.138548431; Z-score: 0.329337682 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.075409361; Fold-change: -0.309825207; Z-score: -0.733600842 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Urothelium | |
The Specific Disease | Ureter cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.555532214; Fold-change: 0.028080992; Z-score: 0.106244127 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 20
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adipose | |
The Specific Disease | Simpson golabi behmel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.870568347; Fold-change: 0.115329029; Z-score: 1.409796016 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Perituberal | |
The Specific Disease | Tuberous sclerosis complex | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.794618637; Fold-change: -0.03462311; Z-score: -0.141545081 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 3
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Anemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.767378098; Fold-change: 0.125870427; Z-score: 0.345815156 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Sickle cell disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.071328832; Fold-change: 0.053762935; Z-score: 0.256413288 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocythemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.13E-05; Fold-change: -0.087767183; Z-score: -0.992090878 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 4
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Scleroderma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.416115571; Fold-change: -0.001149627; Z-score: -0.007275695 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Salivary gland | |
The Specific Disease | Sjogren syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.339900466; Fold-change: 0.104244501; Z-score: 0.654516146 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.449214338; Fold-change: -0.042833625; Z-score: -0.207942269 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Behcet disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.173820912; Fold-change: 0.042293903; Z-score: 0.161630857 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autosomal dominant monocytopenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.418446222; Fold-change: 0.004696327; Z-score: 0.031074786 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 5
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Type 2 diabetes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.109885245; Fold-change: -0.245496172; Z-score: -0.848369884 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Vastus lateralis muscle | |
The Specific Disease | Polycystic ovary syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.333606564; Fold-change: 0.076509719; Z-score: 0.474361505 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Subcutaneous Adipose | |
The Specific Disease | Obesity | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.295147691; Fold-change: -0.055501484; Z-score: -0.209240777 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Biceps muscle | |
The Specific Disease | Pompe disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.034025183; Fold-change: 0.206686327; Z-score: 0.813611913 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Batten disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.361024558; Fold-change: 0.051703244; Z-score: 0.257784286 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 6
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autism | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.648850003; Fold-change: -0.005518381; Z-score: -0.023405594 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Anxiety disorder | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.374329727; Fold-change: -0.093460645; Z-score: -0.25455533 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
ICD Disease Classification 8
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Substantia nigra | |
The Specific Disease | Parkinson disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.549490593; Fold-change: 0.189104071; Z-score: 0.564057593 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Huntington disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.884777761; Fold-change: 0.039392193; Z-score: 0.14259095 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Entorhinal cortex | |
The Specific Disease | Alzheimer disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.84E-06; Fold-change: 0.185664893; Z-score: 0.596495701 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Seizure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.19991542; Fold-change: -0.020037703; Z-score: -0.123030552 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.748138451; Fold-change: 0.182017883; Z-score: 0.374953548 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
The Studied Tissue | Cervical spinal cord | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.297217674; Fold-change: -0.008848181; Z-score: -0.013034733 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Muscular atrophy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.31505617; Fold-change: -0.13091148; Z-score: -0.352031601 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Myopathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.846237301; Fold-change: -0.067532284; Z-score: -0.167058271 | |
Disease-specific Antigen Abundances |
![]() |
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.