Antigen Information
General Information of This Antigen
| Antigen ID | TAR0WOWID |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Integrin alpha-V (ITGAV) |
|||||
| Gene Name | ITGAV |
|||||
| Gene ID | ||||||
| Synonym | Vitronectin receptor;Vitronectin receptor subunit alpha;CD_antigen=CD51 |
|||||
| Sequence |
MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK AQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP DHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF FKRVRPPQEEQEREQLQPHENGEGNSET Click to Show/Hide
|
|||||
| Family | Integrin alpha chain family |
|||||
| Function |
The alpha-V (ITGAV) integrins are receptors for vitronectin, cytotactin, fibronectin, fibrinogen, laminin, matrix metalloproteinase- 2, osteopontin, osteomodulin, prothrombin, thrombospondin and vWF. They recognize the sequence R-G-D in a wide array of ligands. ITGAV:ITGB3 binds to fractalkine (CX3CL1) and may act as its coreceptor in CX3CR1- dependent fractalkine signaling. ITGAV:ITGB3 binds to NRG1 (via EGF domain) and this binding is essential for NRG1-ERBB signaling. ITGAV:ITGB3 binds to FGF1 and this binding is essential for FGF1 signaling. ITGAV:ITGB3 binds to FGF2 and this binding is essential for FGF2 signaling. ITGAV:ITGB3 binds to IGF1 and this binding is essential for IGF1 signaling. ITGAV:ITGB3 binds to IGF2 and this binding is essential for IGF2 signaling. ITGAV:ITGB3 binds to IL1B and this binding is essential for IL1B signaling. ITGAV:ITGB3 binds to PLA2G2A via a site (site 2) which is distinct from the classical ligand-binding site (site 1) and this induces integrin conformational changes and enhanced ligand binding to site 1. ITGAV:ITGB3 and ITGAV:ITGB6 act as receptors for fibrillin-1 (FBN1) and mediate R-G-D-dependent cell adhesion to FBN1. Integrin alpha-V/beta-6 or alpha- V/beta-8 (ITGAV:ITGB6 or ITGAV:ITGB8) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF- beta-1 activation. ITGAV:ITGB3 acts as a receptor for CD40LG.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
CNTO95
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
CNTO95-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[1] | |
CNTO95-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[1] | |
CNTO95-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[1] | |
CNTO95-SSNPB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-sulfosuccinimidyl-4-(5-nitro-2 pyridyldithio) butyrate (SSNPB) |
[1] | |
CNTO95-SSNPP-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[1] | |
CNTO95-SPP-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[1] |
F105
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
F105-DM1 |
Mertansine DM1 |
Microtubule (MT) |
Succinimidyl-4-(N-maleimidomethyl)cyclohexane-1-carboxylate (SMCC) |
[1] | |
F105-SPP-DM1 |
Mertansine DM1 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[1] | |
F105-SPDB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) butanoate (SPDB) |
[1] | |
F105-SSNPB-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-sulfosuccinimidyl-4-(5-nitro-2 pyridyldithio) butyrate (SSNPB) |
[1] | |
F105-SSNPP-DM4 |
Mertansine DM4 |
Microtubule (MT) |
Sulfosuccinimidyl-N-succinimidyl-4-(5-nitro-2-pyridyldithio) pentanoate (SSNPP) |
[1] | |
F105-SPP-DM4 |
Mertansine DM4 |
Microtubule (MT) |
N-succinimidyl 4-(2-pyridyldithio) pentanoate (SPP) |
[1] |
IMGN-388
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
IMGN-388 |
Mertansine DM4 |
Microtubule (MT) |
Undisclosed |
[2] |
Undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
SAB-Y9-13 |
Undisclosed |
Undisclosed |
Undisclosed |
[3] | |
SAB-Y9 |
Undisclosed |
Undisclosed |
Undisclosed |
[3] |
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Bacterial infection of gingival | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.225666615; Fold-change: 0.025806317; Z-score: 0.078306112 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 02
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Brainstem | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002276124; Fold-change: 0.734282352; Z-score: 5.970038179 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | White matter | |
| The Specific Disease | Glioma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.559201339; Fold-change: 0.05731607; Z-score: 0.147064858 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Brainstem | |
| The Specific Disease | Neuroectodermal tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.236691425; Fold-change: -0.363000137; Z-score: -0.764646044 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Nervous | |
| The Specific Disease | Brain cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 6.23E-114; Fold-change: 1.17921277; Z-score: 2.053209062 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Polycythemia vera | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.484199435; Fold-change: 0.179326517; Z-score: 0.279011529 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Whole blood | |
| The Specific Disease | Myelofibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.221803746; Fold-change: 0.343330041; Z-score: 0.55306147 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myelodysplastic syndromes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.181763076; Fold-change: 0.321762209; Z-score: 0.520172799 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.097577924; Fold-change: 1.246837371; Z-score: 1.320902685 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Tonsil | |
| The Specific Disease | Lymphoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.76304671; Fold-change: -0.047023745; Z-score: -0.05504224 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric | |
| The Specific Disease | Gastric cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.167782262; Fold-change: 0.63825531; Z-score: 1.404287492 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.478798515; Fold-change: -0.035994251; Z-score: -0.070029907 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon | |
| The Specific Disease | Colon cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.68E-50; Fold-change: 0.623186963; Z-score: 1.835714746 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 8.80E-07; Fold-change: 0.236634109; Z-score: 0.500900785 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pancreas | |
| The Specific Disease | Pancreatic cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000883356; Fold-change: 0.712977721; Z-score: 1.135400616 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.40E-13; Fold-change: 1.020948191; Z-score: 1.470684814 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.84E-08; Fold-change: 0.993697899; Z-score: 1.578698381 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.002398675; Fold-change: 0.236727666; Z-score: 0.346147988 | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.039110809; Fold-change: 0.674901984; Z-score: 1.45816795 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Lung cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.97E-32; Fold-change: 0.480535785; Z-score: 1.485851325 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.54E-27; Fold-change: 0.656459169; Z-score: 1.648898409 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Melanoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.793287212; Fold-change: 0.030730961; Z-score: 0.059848072 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Sarcoma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.35E-53; Fold-change: 0.71416122; Z-score: 1.262492158 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.00015269; Fold-change: 1.359992485; Z-score: 7.087254722 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Breast | |
| The Specific Disease | Breast cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.98E-06; Fold-change: 0.146735077; Z-score: 0.259636024 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.00037101; Fold-change: 0.451171812; Z-score: 0.77539599 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Ovarian | |
| The Specific Disease | Ovarian cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.019641632; Fold-change: -0.379928975; Z-score: -0.764882051 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.01E-07; Fold-change: -0.799926703; Z-score: -2.561146145 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Cervical | |
| The Specific Disease | Cervical cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.013211395; Fold-change: 0.306448154; Z-score: 0.718954458 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Uterine cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.013009334; Fold-change: 0.221996156; Z-score: 0.347759147 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.074583576; Fold-change: -0.203593144; Z-score: -0.750424569 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Prostate | |
| The Specific Disease | Prostate cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.715766185; Fold-change: -0.054168523; Z-score: -0.103198186 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Bladder cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.007967016; Fold-change: -0.343047153; Z-score: -1.506139776 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Uvea | |
| The Specific Disease | Retinoblastoma tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.04E-05; Fold-change: -0.861089358; Z-score: -3.647947251 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Thyroid | |
| The Specific Disease | Thyroid cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.01E-08; Fold-change: 0.254320727; Z-score: 0.961021498 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.041058959; Fold-change: 0.254534767; Z-score: 0.792330345 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adrenal cortex | |
| The Specific Disease | Adrenocortical carcinoma | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.000571091; Fold-change: -0.198160224; Z-score: -0.921549548 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Head and neck | |
| The Specific Disease | Head and neck cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 1.86E-68; Fold-change: 1.58366704; Z-score: 3.773622911 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary gonadotrope tumor | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.767372712; Fold-change: 0.16703161; Z-score: 0.331198466 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Pituitary | |
| The Specific Disease | Pituitary cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.248185143; Fold-change: 0.210088472; Z-score: 0.479103376 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 03
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.723418368; Fold-change: 0.130831413; Z-score: 0.094726852 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 04
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Lupus erythematosus | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.171384378; Fold-change: 0.126650073; Z-score: 0.170345081 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral monocyte | |
| The Specific Disease | Autoimmune uveitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.171815228; Fold-change: 0.52348282; Z-score: 1.06421198 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 05
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Familial hypercholesterolemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.12E-07; Fold-change: 0.92638195; Z-score: 1.350180308 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 06
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Superior temporal cortex | |
| The Specific Disease | Schizophrenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.952036569; Fold-change: -0.072383457; Z-score: -0.203499612 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 08
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Spinal cord | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.764058596; Fold-change: 0.250189056; Z-score: 1.141406323 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Plasmacytoid dendritic cells | |
| The Specific Disease | Multiple sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.020419793; Fold-change: -0.369360973; Z-score: -2.341033805 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peritumoral cortex | |
| The Specific Disease | Epilepsy | |
| The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.243054447; Fold-change: -0.909814202; Z-score: -0.776473076 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Cardioembolic Stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.033872169; Fold-change: 0.363918696; Z-score: 0.903733672 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Ischemic stroke | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.335667983; Fold-change: -0.235643042; Z-score: -0.527050387 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 1
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | White matter | |
| The Specific Disease | HIV | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.115424925; Fold-change: 0.406938579; Z-score: 0.713375341 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Influenza | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003501993; Fold-change: -1.226257934; Z-score: -4.693865477 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Chronic hepatitis C | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.318994039; Fold-change: 0.44236805; Z-score: 0.507309898 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Sepsis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011352651; Fold-change: 0.148868011; Z-score: 0.195656608 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Septic shock | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.470384098; Fold-change: -0.045047284; Z-score: -0.066484974 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Pediatric respiratory syncytial virus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.010691284; Fold-change: 0.192885002; Z-score: 0.632225904 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 11
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Essential hypertension | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.948050076; Fold-change: -0.11697493; Z-score: -0.372837562 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myocardial infarction | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.672326119; Fold-change: -0.032126347; Z-score: -0.071607555 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Coronary artery disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.870485977; Fold-change: 0.790952344; Z-score: 0.433455573 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Calcified aortic valve | |
| The Specific Disease | Aortic stenosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.872397782; Fold-change: 0.09245408; Z-score: 0.068087121 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arteriosclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.917845187; Fold-change: -0.031039005; Z-score: -0.100612641 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Intracranial artery | |
| The Specific Disease | Aneurysm | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000689193; Fold-change: 0.736649367; Z-score: 1.212639179 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 12
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Immunodeficiency | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001237347; Fold-change: -0.400741087; Z-score: -2.604083114 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Hyperplastic tonsil | |
| The Specific Disease | Apnea | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.456208086; Fold-change: 0.137476536; Z-score: 0.224220793 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Olive pollen allergy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.681162154; Fold-change: -0.444269548; Z-score: -0.510172834 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Sinus mucosa | |
| The Specific Disease | Chronic rhinosinusitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.180809282; Fold-change: 0.237448958; Z-score: 0.50812531 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.311916802; Fold-change: 0.02715536; Z-score: 0.094705409 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Small airway epithelium | |
| The Specific Disease | Chronic obstructive pulmonary disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.114148719; Fold-change: 0.157832724; Z-score: 0.386994154 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal and bronchial airway | |
| The Specific Disease | Asthma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001505618; Fold-change: 0.142470845; Z-score: 0.253197663 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Nasal Epithelium | |
| The Specific Disease | Human rhinovirus infection | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.178764354; Fold-change: 0.171657196; Z-score: 0.682535249 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Lung | |
| The Specific Disease | Idiopathic pulmonary fibrosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.016268806; Fold-change: 0.265144938; Z-score: 0.860644404 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 13
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gingival | |
| The Specific Disease | Periodontal disease | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.052022765; Fold-change: -0.030733656; Z-score: -0.087248752 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Gastric antrum | |
| The Specific Disease | Eosinophilic gastritis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.626315259; Fold-change: -0.258825825; Z-score: -1.751703143 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Liver failure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003775783; Fold-change: 0.942611217; Z-score: 1.473886129 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Colon mucosal | |
| The Specific Disease | Ulcerative colitis | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.090404375; Fold-change: 0.476840052; Z-score: 0.604186153 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Irritable bowel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.004835271; Fold-change: 0.166925218; Z-score: 0.620922785 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 14
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Atopic dermatitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.441971892; Fold-change: -0.005722767; Z-score: -0.034830414 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Psoriasis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.10E-07; Fold-change: -0.178654199; Z-score: -0.695341064 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.044247459; Fold-change: 0.067587994; Z-score: 0.233049186 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Vitiligo | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001141092; Fold-change: 0.144950917; Z-score: 1.20803432 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin from scalp | |
| The Specific Disease | Alopecia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.051845706; Fold-change: 0.013793594; Z-score: 0.055979635 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Sensitive skin | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.78913347; Fold-change: 0.011094266; Z-score: 0.046662945 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 15
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Osteoarthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.039002386; Fold-change: 0.353733152; Z-score: 0.506072629 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthropathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.848770123; Fold-change: -0.117369962; Z-score: -0.193195409 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.047734353; Fold-change: -0.052048125; Z-score: -0.06146594 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Synovial | |
| The Specific Disease | Rheumatoid arthritis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.173782358; Fold-change: 0.087137784; Z-score: 0.138053163 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Pheripheral blood | |
| The Specific Disease | Ankylosing spondylitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.10420127; Fold-change: -0.314257052; Z-score: -0.801109668 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Osteoporosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.685940407; Fold-change: -0.282713271; Z-score: -0.492123621 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 16
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Endometrium | |
| The Specific Disease | Endometriosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.259852831; Fold-change: -0.388772794; Z-score: -0.675186687 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bladder | |
| The Specific Disease | Interstitial cystitis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.2678205; Fold-change: 0.066944487; Z-score: 0.444052117 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 19
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Myometrium | |
| The Specific Disease | Preterm birth | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.549527185; Fold-change: -0.005484956; Z-score: -0.016596723 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 2
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Acute myelocytic leukemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.010984188; Fold-change: 0.143654444; Z-score: 0.206537029 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000169971; Fold-change: 2.052604166; Z-score: 2.870477266 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Myeloma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.690678698; Fold-change: -0.04215345; Z-score: -0.114654747 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Oral | |
| The Specific Disease | Oral cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.29E-08; Fold-change: 1.140620151; Z-score: 1.199963535 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.16E-22; Fold-change: 0.72410788; Z-score: 1.889957384 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Esophagus | |
| The Specific Disease | Esophagal cancer | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.01126205; Fold-change: 0.857795078; Z-score: 1.962649489 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Rectal colon | |
| The Specific Disease | Rectal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011243282; Fold-change: 0.714515832; Z-score: 1.790645573 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.58E-09; Fold-change: 0.847722433; Z-score: 5.797815977 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Skin cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.42E-05; Fold-change: -0.07057331; Z-score: -0.235296258 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.996746197; Fold-change: 0.10674502; Z-score: 0.270159464 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Kidney | |
| The Specific Disease | Renal cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.001318361; Fold-change: 0.81262024; Z-score: 1.658002189 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 6.90E-07; Fold-change: 0.533735915; Z-score: 1.109534239 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Urothelium | |
| The Specific Disease | Ureter cancer | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.877892957; Fold-change: 0.118965421; Z-score: 0.162334017 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 20
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Adipose | |
| The Specific Disease | Simpson golabi behmel syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.942011314; Fold-change: -0.153282688; Z-score: -0.143505462 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Perituberal | |
| The Specific Disease | Tuberous sclerosis complex | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.039881219; Fold-change: 0.381643645; Z-score: 1.500580916 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 3
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Bone marrow | |
| The Specific Disease | Anemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.886262079; Fold-change: -0.01995633; Z-score: -0.024695157 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Sickle cell disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.109305377; Fold-change: -0.539273033; Z-score: -0.602943887 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Thrombocythemia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.640923755; Fold-change: 0.298653811; Z-score: 0.465157927 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 4
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Scleroderma | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.054816928; Fold-change: 0.133220595; Z-score: 0.516817866 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Salivary gland | |
| The Specific Disease | Sjogren syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.302118327; Fold-change: 0.520350735; Z-score: 1.213696231 | |
| The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.007674761; Fold-change: 0.800375819; Z-score: 2.775160751 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Peripheral blood | |
| The Specific Disease | Behcet disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.361768127; Fold-change: 0.099992571; Z-score: 0.264475247 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autosomal dominant monocytopenia | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.253446547; Fold-change: -0.079157563; Z-score: -0.123932817 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 5
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Liver | |
| The Specific Disease | Type 2 diabetes | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002255181; Fold-change: 0.533987822; Z-score: 3.09357415 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Vastus lateralis muscle | |
| The Specific Disease | Polycystic ovary syndrome | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.922789217; Fold-change: -0.072732072; Z-score: -0.187881529 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Subcutaneous Adipose | |
| The Specific Disease | Obesity | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.005283904; Fold-change: 0.201876622; Z-score: 0.864124612 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Biceps muscle | |
| The Specific Disease | Pompe disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.035931824; Fold-change: 0.286338434; Z-score: 1.134843604 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Batten disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.630414887; Fold-change: 0.054979047; Z-score: 0.224138925 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 6
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Autism | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.032876704; Fold-change: 0.366779731; Z-score: 0.583988734 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Anxiety disorder | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.793996567; Fold-change: -0.237018097; Z-score: -0.234402909 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
ICD Disease Classification 8
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Substantia nigra | |
| The Specific Disease | Parkinson disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.832378294; Fold-change: 0.057740271; Z-score: 0.209161426 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Huntington disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.740097885; Fold-change: -0.218218083; Z-score: -0.553869049 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Entorhinal cortex | |
| The Specific Disease | Alzheimer disease | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000204965; Fold-change: 0.171553991; Z-score: 0.369279037 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Whole blood | |
| The Specific Disease | Seizure | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.387529863; Fold-change: 0.282840414; Z-score: 0.497399413 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Skin | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.058132055; Fold-change: -0.2442356; Z-score: -1.344014849 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| The Studied Tissue | Cervical spinal cord | |
| The Specific Disease | Lateral sclerosis | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.298887342; Fold-change: -0.426866316; Z-score: -0.676845751 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Muscular atrophy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.807498447; Fold-change: -0.119646721; Z-score: -0.255142377 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
| Differential expression pattern of antigen in diseases | ||
| The Studied Tissue | Muscle | |
| The Specific Disease | Myopathy | |
| The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.008463125; Fold-change: 0.319505775; Z-score: 0.826873914 | |
| Disease-specific Antigen Abundances |
|
Click to View the Clearer Original Diagram |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.
