Antigen Information
General Information of This Antigen
| Antigen ID | TAR0LXDND |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Lymphocyte antigen 6E (LY6E) |
|||||
| Gene Name | LY6E |
|||||
| Synonym | Retinoic acid-induced gene E protein;Stem cell antigen 2;Thymic shared antigen 1 |
|||||
| Sequence |
MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNL
VTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLL SLLPALLRFGP Click to Show/Hide
|
|||||
| Function |
GPI-anchored cell surface protein that regulates T- lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of human coronaviruses, including SARS-CoV, MERS-CoV and SARS-CoV-2, by interfering with spike protein-mediated membrane fusion. Also plays an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT- I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Anti-gD-LC-K149C
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Alpha-gD-LC-K149C-10 |
seco-CBI-dimer |
Human Deoxyribonucleic acid (hDNA) |
Mc-peptidomimetic based linker 10 |
[1] |
Anti-Ly6E antibody
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
m7437 |
Exatecan |
DNA topoisomerase 1 (TOP1) |
Undisclosed |
Anti-Ly6E-LC-K149C
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
Alpha-Ly6E-LC-K149C-11 |
seco-CBI-dimer |
Human Deoxyribonucleic acid (hDNA) |
Mal-PEG2 |
[1] |
MLYE4489A
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
RG7841 |
MMAE |
Microtubule (MT) |
Mc-Val-Cit-PABC |
Thio hu Anti-Ly6E 9B12.v12 LC K149C
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
WO2016205176A1 ADC-101 |
WO2016205176A1_ADC-101 payload |
Undisclosed |
WO2016205176A1_ADC-101 linker |
[2] | |
WO2016205176A1 ADC-102 |
WO2016205176A1_ADC-102 payload |
Undisclosed |
WO2016205176A1_ADC-102 linker |
[2] | |
WO2016205176A1 ADC-103 |
WO2016205176A1_ADC-103 payload |
Undisclosed |
WO2016205176A1_ADC-103 linker |
[2] | |
WO2017059289A1 ADC-115 |
WO2017059289A1_ADC-115 payload |
Undisclosed |
WO2017059289A1_ADC-115 linker |
[3] | |
WO2017059289A1 ADC-210 |
WO2017059289A1_ADC-210 payload |
Undisclosed |
WO2017059289A1_ADC-210 linker |
[3] | |
WO2017214024A1 ADC-107 |
WO2017214024A1_ADC-107 payload |
Undisclosed |
WO2017214024A1_ADC-107 linker |
[4] | |
WO2017214024A1 ADC-109 |
WO2017214024A1_ADC-109 payload |
Undisclosed |
WO2017214024A1_ADC-109 linker |
[4] |
Thio hu Anti-Ly6E LC K149C
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
WO2017059289A1 ADC-212 |
WO2017059289A1_ADC-212 payload |
Undisclosed |
WO2017059289A1_ADC-212 linker |
[3] |
undisclosed
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
ZW327 |
Undisclosed |
Undisclosed |
Mc-Gly-Gly-Phe-Gly |
[5] |
References
