General Information of This Antibody
Antibody ID
ANI0EFHGU
Antibody Name
Thio hu anti-Ly6E 9B12.v12 LC K149C
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized IgG1-kappa
Antigen Name
Lymphocyte antigen 6E (LY6E)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVESGPALVKPTQTLTLTCTVSGESLTGYSVNWIRQPPGKALEWLGMIWGDGSTDYN
SALKSRLTISKDTSKNQVVLTMTNMDEVDTATYYCARDYYENYASWEAYWGQGTLVTVSS
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTPCPAPELLGGYICNVNHKPSNTKVDKKVEPKSCDKTHTCP
HEDPEVKENWPSVELFPPKPKDTLMISRTPEVTCVVDVSYVDGVEVHNASTYRVVSVLTV
LHQDWLNGKKTKPREEQYNEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVQQGNVESCSVLDSDGSFFLYS
KLTVDKSRWMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIQMTQSPSSLSASVGDRVTITCSASQGISNYLNWYQQKPGKTVKLLIYYTSNLHSGVPS
RFSGSGSGTDYTLTISSLQPEDEATYYCQQYSELPWTFGQGTKVEIKRTVAAPSVEIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWCVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
WO2016205176A1 ADC-102 [Investigative]
Discovered Using Patient-derived Xenograft Model
Click To Hide/Show 6 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 0.00% (Day 28) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.1 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model Triple negative breast cancer PDX model (PDX: HBCx9)
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 32.11% (Day 28) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.3 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model Triple negative breast cancer PDX model (PDX: HBCx9)
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 73.25% (Day 28) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.6 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model Triple negative breast cancer PDX model (PDX: HBCx9)
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 79.64% (Day 21) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model Triple negative breast cancer PDX model (PDX: HCI-009)
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 83.52% (Day 21) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model Triple negative breast cancer PDX model (PDX: HCI-009)
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 83.52% (Day 21) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.1 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model Triple negative breast cancer PDX model (PDX: HCI-009)
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 11 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 0.00% (Day 22) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million NCI-H1781 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model NCI-H1781 CDX model
In Vitro Model Minimally invasive lung adenocarcinoma NCI-H1781 cells CVCL_1494
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 39.52% (Day 21) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million PC-9 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.
In Vivo Model PC-9 CDX model
In Vitro Model Lung adenocarcinoma PC-9 cells CVCL_B260
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 45.74% (Day 22) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million NCI-H1781 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model NCI-H1781 CDX model
In Vitro Model Minimally invasive lung adenocarcinoma NCI-H1781 cells CVCL_1494
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 53.26% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 67.78% (Day 21) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million PC-9 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.
In Vivo Model PC-9 CDX model
In Vitro Model Lung adenocarcinoma PC-9 cells CVCL_B260
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 71.88% (Day 21) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million PC-9 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.
In Vivo Model PC-9 CDX model
In Vitro Model Lung adenocarcinoma PC-9 cells CVCL_B260
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 73.90% (Day 21) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million PC-9 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (2 mg/kg) through tail vein.
In Vivo Model PC-9 CDX model
In Vitro Model Lung adenocarcinoma PC-9 cells CVCL_B260
Experiment 8 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 85.20% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 9 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 92.27% (Day 22) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million NCI-H1781 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (2 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model NCI-H1781 CDX model
In Vitro Model Minimally invasive lung adenocarcinoma NCI-H1781 cells CVCL_1494
Experiment 10 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 93.78% (Day 22) Low LY6E expression (LY6E+)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million NCI-H1781 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model NCI-H1781 CDX model
In Vitro Model Minimally invasive lung adenocarcinoma NCI-H1781 cells CVCL_1494
Experiment 11 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 95.33% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
WO2017214024A1 ADC-109 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 19.51% (Day 10) Moderate CD22 expression (CD22++)
Method Description
Inoculate 150 mice with BJAB cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (10 mg/kg) via the tail vein on Day 0.

   Click to Show/Hide
In Vivo Model BJAB CDX model
In Vitro Model Burkitt lymphoma BJAB cells CVCL_5711
WO2017059289A1 ADC-115 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 24.12% (Day 13) Positive HER2 expression (HER2 +++/++)
Method Description
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (3 mg/kg) via the tail vein on Day 0.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 50.80% (Day 13) Positive HER2 expression (HER2 +++/++)
Method Description
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (6 mg/kg) via the tail vein on Day 0.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 66.89% (Day 13) Positive HER2 expression (HER2 +++/++)
Method Description
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (12 mg/kg) via the tail vein on Day 0.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 4 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 79.46% (Day 13) Positive HER2 expression (HER2 +++/++)
Method Description
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (18 mg/kg) via the tail vein on Day 0.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
WO2017214024A1 ADC-107 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 1 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [2]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 30.37% (Day 10) Moderate CD22 expression (CD22++)
Method Description
Inoculate 150 mice with BJAB cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (6 mg/kg) via the tail vein on Day 0.

   Click to Show/Hide
In Vivo Model BJAB CDX model
In Vitro Model Burkitt lymphoma BJAB cells CVCL_5711
WO2016205176A1 ADC-103 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 5 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 76.24% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.3 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.29% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.29% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (3 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.29% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (6 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 98.34% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (10 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
WO2017059289A1 ADC-210 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 89.77% (Day 13) Positive HER2 expression (HER2 +++/++)
Method Description
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (1 mg/kg) via the tail vein on Day 0.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 2 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 96.20% (Day 13) Positive HER2 expression (HER2 +++/++)
Method Description
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (3 mg/kg) via the tail vein on Day 0.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 3 Reporting the Activity Date of This ADC [3]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 97.00% (Day 13) Positive HER2 expression (HER2 +++/++)
Method Description
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (6 mg/kg) via the tail vein on Day 0.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
WO2016205176A1 ADC-101 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
Click To Hide/Show 3 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 90.91% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 95.17% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Tumor Growth Inhibition value (TGI) ≈ 97.02% (Day 14) Moderate LY6E expression (LY6E++)
Method Description
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.

   Click to Show/Hide
In Vivo Model HCC1569 CDX model
In Vitro Model Breast ductal carcinoma HCC1569 cells CVCL_1255
References
Ref 1 Antibodies and immunoconjugates; 2016-12-22.
Ref 2 Silvestrol antibody-drug conjugates and methods of use; 2017-12-14.
Ref 3 Pyrrolobenzodiazepine antibody drug conjugates and methods of use; 2017-04-06.