Antibody Information
General Information of This Antibody
| Antibody ID | ANI0EFHGU |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | Thio hu anti-Ly6E 9B12.v12 LC K149C |
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized IgG1-kappa |
|||||
| Antigen Name | Lymphocyte antigen 6E (LY6E) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
EVQLVESGPALVKPTQTLTLTCTVSGESLTGYSVNWIRQPPGKALEWLGMIWGDGSTDYN
SALKSRLTISKDTSKNQVVLTMTNMDEVDTATYYCARDYYENYASWEAYWGQGTLVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTPCPAPELLGGYICNVNHKPSNTKVDKKVEPKSCDKTHTCP HEDPEVKENWPSVELFPPKPKDTLMISRTPEVTCVVDVSYVDGVEVHNASTYRVVSVLTV LHQDWLNGKKTKPREEQYNEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEM TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVQQGNVESCSVLDSDGSFFLYS KLTVDKSRWMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Light Chain Sequence |
DIQMTQSPSSLSASVGDRVTITCSASQGISNYLNWYQQKPGKTVKLLIYYTSNLHSGVPS
RFSGSGSGTDYTLTISSLQPEDEATYYCQQYSELPWTFGQGTKVEIKRTVAAPSVEIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWCVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSENRGEC Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
WO2016205176A1 ADC-102 [Investigative]
Discovered Using Patient-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 0% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.1 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | Triple negative breast cancer PDX model (PDX: HBCx9) | ||||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 32.11% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.3 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | Triple negative breast cancer PDX model (PDX: HBCx9) | ||||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 73.25% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.6 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | Triple negative breast cancer PDX model (PDX: HBCx9) | ||||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 79.64% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | Triple negative breast cancer PDX model (PDX: HCI-009) | ||||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 83.52% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.1 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | Triple negative breast cancer PDX model (PDX: HCI-009) | ||||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 83.52% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million breast cancer cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | Triple negative breast cancer PDX model (PDX: HCI-009) | ||||
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 0% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million NCI-H1781 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | NCI-H1781 CDX model | ||||
| In Vitro Model | Minimally invasive lung adenocarcinoma | NCI-H1781 cells | CVCL_1494 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 39.52% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million PC-9 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.
|
||||
| In Vivo Model | PC-9 CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | PC-9 cells | CVCL_B260 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 45.74% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million NCI-H1781 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | NCI-H1781 CDX model | ||||
| In Vitro Model | Minimally invasive lung adenocarcinoma | NCI-H1781 cells | CVCL_1494 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 53.26% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 67.78% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million PC-9 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.
|
||||
| In Vivo Model | PC-9 CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | PC-9 cells | CVCL_B260 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 71.88% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million PC-9 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.
|
||||
| In Vivo Model | PC-9 CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | PC-9 cells | CVCL_B260 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 73.90% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million PC-9 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (2 mg/kg) through tail vein.
|
||||
| In Vivo Model | PC-9 CDX model | ||||
| In Vitro Model | Lung adenocarcinoma | PC-9 cells | CVCL_B260 | ||
| Experiment 8 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 85.20% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 9 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 92.27% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million NCI-H1781 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (2 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | NCI-H1781 CDX model | ||||
| In Vitro Model | Minimally invasive lung adenocarcinoma | NCI-H1781 cells | CVCL_1494 | ||
| Experiment 10 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 93.78% | Low LY6E expression (LY6E+) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million NCI-H1781 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | NCI-H1781 CDX model | ||||
| In Vitro Model | Minimally invasive lung adenocarcinoma | NCI-H1781 cells | CVCL_1494 | ||
| Experiment 11 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95.33% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
WO2017214024A1 ADC-109 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 19.51% | Moderate CD22 expression (CD22++) | ||
| Method Description |
Inoculate 150 mice with BJAB cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (10 mg/kg) via the tail vein on Day 0.
Click to Show/Hide
|
||||
| In Vivo Model | BJAB CDX model | ||||
| In Vitro Model | Burkitt lymphoma | BJAB cells | CVCL_5711 | ||
WO2017059289A1 ADC-115 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 24.12% | Positive HER2 expression (HER2 +++/++) | ||
| Method Description |
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (3 mg/kg) via the tail vein on Day 0.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 50.80% | Positive HER2 expression (HER2 +++/++) | ||
| Method Description |
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (6 mg/kg) via the tail vein on Day 0.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 66.89% | Positive HER2 expression (HER2 +++/++) | ||
| Method Description |
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (12 mg/kg) via the tail vein on Day 0.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 79.46% | Positive HER2 expression (HER2 +++/++) | ||
| Method Description |
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (18 mg/kg) via the tail vein on Day 0.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
WO2017214024A1 ADC-107 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [2] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 30.37% | Moderate CD22 expression (CD22++) | ||
| Method Description |
Inoculate 150 mice with BJAB cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (6 mg/kg) via the tail vein on Day 0.
Click to Show/Hide
|
||||
| In Vivo Model | BJAB CDX model | ||||
| In Vitro Model | Burkitt lymphoma | BJAB cells | CVCL_5711 | ||
WO2016205176A1 ADC-103 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 76.24% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.3 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.29% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (6 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.29% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (3 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.29% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 98.34% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (10 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
WO2017059289A1 ADC-210 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 89.77% | Positive HER2 expression (HER2 +++/++) | ||
| Method Description |
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (1 mg/kg) via the tail vein on Day 0.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 96.20% | Positive HER2 expression (HER2 +++/++) | ||
| Method Description |
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (3 mg/kg) via the tail vein on Day 0.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [3] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 97% | Positive HER2 expression (HER2 +++/++) | ||
| Method Description |
Inoculate 150 mice with HCC1569 cells at 3 million cells/mouse suspended in HBSS/matrigel, in the thoracic mammary fat pad at a volume of 0.2 ml. When tumors have reached a mean tumor volume of 100-250 mm3, they will be grouped out into 10 groups of 8-10 mice each. A single treatment will be administered intravenously (6 mg/kg) via the tail vein on Day 0.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
WO2016205176A1 ADC-101 [Investigative]
Discovered Using Cell Line-derived Xenograft Model
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 90.91% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.2 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 95.17% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (0.5 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Tumor Growth Inhibition value (TGI) | ≈ 97.02% | Moderate LY6E expression (LY6E++) | ||
| Method Description |
Female C.B-17 SCD-beige mice were each inoculated in the thoracic mammary fat pad area with 5 million HCC1569 cells suspended in HBSS/matrigel. When the xenograft tumors reached an average tumor volume of 100-300 mm(referred to as Day 0), animals were received a single intravenous injection of the antibody-drug conjugate (1 mg/kg) through tail vein.
Click to Show/Hide
|
||||
| In Vivo Model | HCC1569 CDX model | ||||
| In Vitro Model | Breast ductal carcinoma | HCC1569 cells | CVCL_1255 | ||
References
