General Information of This Antigen
Antigen ID
TAR0KZVDX
Antigen Name
B-cell antigen receptor complex-associated protein beta chain (CD79B)
Gene Name
CD79B
Gene ID
974
Synonym
B29; IGB; B-cell-specific glycoprotein B29;Ig-beta;Immunoglobulin-associated B29 protein;CD_antigen=CD79b
Sequence
MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFT
VKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY
FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLL
LDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

    Click to Show/Hide
Function
Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.

    Click to Show/Hide
Uniprot Entry
CD79B_HUMAN
HGNC ID
HGNC:1699
KEGG ID
hsa:974
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
CD79b-B Anti-ody
ADC Info ADC Name Payload Target Linker Ref
CD79b-B Antibody-Compound (Ie)
CD79b-B Antibody-Compound (Ie) payload
Undisclosed
CD79b-B Antibody-Compound (Ie) linker
[1]
CD79b-B Antibody-Compound (Ii)
CD79b-B Antibody-Compound (Ii) payload
Undisclosed
CD79b-B Antibody-Compound (Ii) linker
[1]
CD79b-B Antibody-Compound (X)
CD79b-B Antibody-Compound (X) payload
Undisclosed
CD79b-B Antibody-Compound (X) linker
[1]
CD79b-B Antibody-Compound (XI)
CD79b-B Antibody-Compound (XI) payload
Undisclosed
CD79b-B Antibody-Compound (XI) linker
[1]
CD79b-B Antibody-Compound (XIV)
CD79b-B Antibody-Compound (XIV) payload
Undisclosed
CD79b-B Antibody-Compound (XIV) linker
[1]
CD79b-B Antibody-Compound (XIX)
CD79b-B Antibody-Compound (XIX) payload
Undisclosed
CD79b-B Antibody-Compound (XIX) linker
[1]
CD79b-B Antibody-Compound (XL)
CD79b-B Antibody-Compound (XL) payload
Undisclosed
CD79b-B Antibody-Compound (XL) linker
[1]
CD79b-B Antibody-Compound (XLI)
CD79b-B Antibody-Compound (XLI) payload
Undisclosed
CD79b-B Antibody-Compound (XLI) linker
[1]
CD79b-B Antibody-Compound (XLII)
CD79b-B Antibody-Compound (XLII) payload
Undisclosed
CD79b-B Antibody-Compound (XLII) linker
[1]
CD79b-B Antibody-Compound (XLIII)
CD79b-B Antibody-Compound (XLIII) payload
Undisclosed
CD79b-B Antibody-Compound (XLIII) linker
[1]
CD79b-B Antibody-Compound (XV)
CD79b-B Antibody-Compound (XV) payload
Undisclosed
CD79b-B Antibody-Compound (XV) linker
[1]
CD79b-B Antibody-Compound (XVI)
CD79b-B Antibody-Compound (XIX) payload
Undisclosed
CD79b-B Antibody-Compound (XIX) linker
[1]
CD79b-B Antibody-Compound (XVIII)
CD79b-B Antibody-Compound (XVIII) payload
Undisclosed
CD79b-B Antibody-Compound (XVIII) linker
[1]
Iladatuzumab
ADC Info ADC Name Payload Target Linker Ref
Iladatuzumab vedotin
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[2]
Polatuzumab
ADC Info ADC Name Payload Target Linker Ref
Polatuzumab vedotin
Monomethyl auristatin E
Microtubule (MT)
Mc-Val-Cit-PABC
[3]
CD79b-A Antibody-Compound (Ie)
CD79b-A Antibody-Compound (Ie) payload
Undisclosed
CD79b-A Antibody-Compound (Ie) linker
[1]
CD79b-A Antibody-Compound (Ii)
CD79b-A Antibody-Compound (Ii) payload
Undisclosed
CD79b-A Antibody-Compound (Ii) linker
[1]
CD79b-A Antibody-Compound (X)
CD79b-A Antibody-Compound (X) payload
Undisclosed
CD79b-A Antibody-Compound (X) linker
[1]
CD79b-A Antibody-Compound (XI)
CD79b-A Antibody-Compound (XI) payload
Undisclosed
CD79b-A Antibody-Compound (XI) linker
[1]
CD79b-A Antibody-Compound (XIV)
CD79b-A Antibody-Compound (XIV) payload
Undisclosed
CD79b-A Antibody-Compound (XIV) linker
[1]
CD79b-A Antibody-Compound (XIX)
CD79b-A Antibody-Compound (XIX) payload
Undisclosed
CD79b-A Antibody-Compound (XIX) linker
[1]
CD79b-A Antibody-Compound (XL)
CD79b-A Antibody-Compound (XL) payload
Undisclosed
CD79b-A Antibody-Compound (XL) linker
[1]
CD79b-A Antibody-Compound (XLI)
CD79b-A Antibody-Compound (XLI) payload
Undisclosed
CD79b-A Antibody-Compound (XLI) linker
[1]
CD79b-A Antibody-Compound (XLII)
CD79b-A Antibody-Compound (XLII) payload
Undisclosed
CD79b-A Antibody-Compound (XLII) linker
[1]
CD79b-A Antibody-Compound (XLIII)
CD79b-A Antibody-Compound (XLIII) payload
Undisclosed
CD79b-A Antibody-Compound (XLIII) linker
[1]
CD79b-A Antibody-Compound (XVI)
CD79b-A Antibody-Compound (XIX) payload
Undisclosed
CD79b-A Antibody-Compound (XIX) linker
[1]
CD79b-A Antibody-Compound (XVIII)
CD79b-A Antibody-Compound (XVIII) payload
Undisclosed
CD79b-A Antibody-Compound (XVIII) linker
[1]
Polatuzumab-compound (XV)
Polatuzumab-Compound (XV) payload
Undisclosed
Polatuzumab-Compound (XV) linker
[1]
ADC Info ADC Name Payload Target Linker Ref
SHR-A1912
SHR9265
DNA topoisomerase 1 (TOP1)
Mc-Gly-Gly-Phe-Gly
[4]
Undisclosed
ADC Info ADC Name Payload Target Linker Ref
NBT508
Monomethyl auristatin E
Microtubule (MT)
Proprietary site- specific linker (TetraM; Cleavable linker)
[5]
ARC-02
Monomethyl auristatin E
Microtubule (MT)
Undisclosed
[6]
POZ-polymer ADCs
Rotigotine
D(1A) dopamine receptor (DRD1)
Undisclosed
[7]
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Click to Show/Hide the 1 Disease of This Class
Bacterial infection [ICD-11: 1A00-1C4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Bacterial infection of gingival
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.48E-09; Fold-change: 0.429410977; Z-score: 1.008258369
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 02
Click to Show/Hide the 22 Disease of This Class
Brain cancer [ICD-11: 2A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Brainstem
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.929113972; Fold-change: -0.008084545; Z-score: -0.046731304
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue White matter
The Specific Disease Glioma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.86E-06; Fold-change: -0.891598391; Z-score: -2.58383785
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Brainstem
The Specific Disease Neuroectodermal tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.017568213; Fold-change: 0.23212283; Z-score: 0.947875355
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Nervous
The Specific Disease Brain cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 4.18E-14; Fold-change: -0.137726286; Z-score: -0.444264363
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic myeloid leukemia [ICD-11: 2A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Polycythemia vera
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000311275; Fold-change: 0.135504898; Z-score: 0.894889478
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Whole blood
The Specific Disease Myelofibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.339470484; Fold-change: 0.033782029; Z-score: 0.228101792
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
MyeloDysplastic syndromes [ICD-11: 2A37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myelodysplastic syndromes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000310669; Fold-change: -0.324504908; Z-score: -0.827750226
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.093070238; Fold-change: -0.169347734; Z-score: -1.937628252
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lymphoma [ICD-11: 2A90- 2A85]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Tonsil
The Specific Disease Lymphoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.819618548; Fold-change: 0.034549667; Z-score: 0.12221018
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Gastric cancer [ICD-11: 2B72]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric
The Specific Disease Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.448707707; Fold-change: -0.538942008; Z-score: -1.083843406
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.394466552; Fold-change: -0.034843379; Z-score: -0.142704598
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Colon cancer [ICD-11: 2B90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon
The Specific Disease Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.792863073; Fold-change: -0.016368257; Z-score: -0.047667056
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.001179866; Fold-change: -0.117845607; Z-score: -0.410940171
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pancreatic cancer [ICD-11: 2C10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pancreas
The Specific Disease Pancreatic cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.042825493; Fold-change: -0.24574507; Z-score: -0.720867242
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.000102516; Fold-change: -0.17794001; Z-score: -0.348687891
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver cancer [ICD-11: 2C12]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001661707; Fold-change: -0.230803424; Z-score: -0.693551327
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.126117439; Fold-change: 0.014242847; Z-score: 0.059258101
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.987412649; Fold-change: -0.071641656; Z-score: -0.344951212
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lung cancer [ICD-11: 2C25]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Lung cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.07E-09; Fold-change: -0.139022347; Z-score: -0.574264514
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.694312125; Fold-change: -0.051353952; Z-score: -0.186494704
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Melanoma [ICD-11: 2C30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Melanoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.069297911; Fold-change: -0.179976852; Z-score: -0.569657581
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sarcoma [ICD-11: 2C35]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Sarcoma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.00E-12; Fold-change: -0.110896277; Z-score: -0.324085653
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.521271083; Fold-change: 0.059913973; Z-score: 0.285278402
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Breast cancer [ICD-11: 2C60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Breast
The Specific Disease Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.147976556; Fold-change: 0.03167913; Z-score: 0.092871669
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.055605643; Fold-change: 0.133325163; Z-score: 0.370425342
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ovarian cancer [ICD-11: 2C73]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Ovarian
The Specific Disease Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.226597059; Fold-change: -0.229109888; Z-score: -0.689921707
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.190208906; Fold-change: 0.055502612; Z-score: 0.250874288
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cervical cancer [ICD-11: 2C77]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Cervical
The Specific Disease Cervical cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.03744349; Fold-change: 0.042135458; Z-score: 0.155876339
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Uterine cancer [ICD-11: 2C78]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Uterine cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.012865288; Fold-change: -0.136785737; Z-score: -0.376827055
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.031825023; Fold-change: -0.538405543; Z-score: -1.63799641
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Prostate cancer [ICD-11: 2C82]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Prostate
The Specific Disease Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 5.29E-09; Fold-change: 0.457773621; Z-score: 1.503250667
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Bladder cancer [ICD-11: 2C94]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Bladder cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000880096; Fold-change: 0.559174686; Z-score: 2.498305887
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Retina cancer [ICD-11: 2D02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Uvea
The Specific Disease Retinoblastoma tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 2.51E-06; Fold-change: -0.412485991; Z-score: -2.360646675
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thyroid cancer [ICD-11: 2D10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Thyroid
The Specific Disease Thyroid cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.004427159; Fold-change: 0.116585836; Z-score: 0.446965594
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.94690477; Fold-change: 0.023119875; Z-score: 0.10537105
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Adrenal cancer [ICD-11: 2D11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adrenal cortex
The Specific Disease Adrenocortical carcinoma
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.535035755; Fold-change: -0.130395737; Z-score: -0.501567295
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Head and neck cancer [ICD-11: 2D42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Head and neck
The Specific Disease Head and neck cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000650273; Fold-change: 0.139303067; Z-score: 0.536396546
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pituitary cancer [ICD-11: 2F37]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pituitary
The Specific Disease Pituitary gonadotrope tumor
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.262567706; Fold-change: -0.169707775; Z-score: -0.767352343
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Pituitary
The Specific Disease Pituitary cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.29736265; Fold-change: 0.054807807; Z-score: 0.240741301
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 03
Click to Show/Hide the 1 Disease of This Class
Thrombocytopenia [ICD-11: 3B64]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.277961822; Fold-change: -0.302529175; Z-score: -1.206974979
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 04
Click to Show/Hide the 2 Disease of This Class
Lupus erythematosus [ICD-11: 4A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Lupus erythematosus
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.398381689; Fold-change: -0.007512019; Z-score: -0.026269229
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autoimmune disease [ICD-11: 4A4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral monocyte
The Specific Disease Autoimmune uveitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011923467; Fold-change: -0.160027584; Z-score: -0.961241833
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 05
Click to Show/Hide the 1 Disease of This Class
Hyperlipoproteinaemia [ICD-11: 5C80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Familial hypercholesterolemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.006164562; Fold-change: -0.08804197; Z-score: -0.249292626
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 06
Click to Show/Hide the 1 Disease of This Class
Schizophrenia [ICD-11: 6A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Superior temporal cortex
The Specific Disease Schizophrenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.560241341; Fold-change: -0.141804413; Z-score: -0.640258012
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 08
Click to Show/Hide the 3 Disease of This Class
Multiple sclerosis [ICD-11: 8A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Spinal cord
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.265885799; Fold-change: -0.039537767; Z-score: -0.286454507
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Plasmacytoid dendritic cells
The Specific Disease Multiple sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.652654525; Fold-change: 0.219099284; Z-score: 0.571137847
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Epilepsy [ICD-11: 8A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peritumoral cortex
The Specific Disease Epilepsy
The Expression Level of Disease Section Compare with the Other Disease Section p-value: 0.143586088; Fold-change: 0.092535813; Z-score: 0.881007593
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Cerebral ischaemic stroke [ICD-11: 8B11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Cardioembolic Stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.89384203; Fold-change: 0.0321722; Z-score: 0.205203758
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Ischemic stroke
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.764785989; Fold-change: 0.078504331; Z-score: 0.368483362
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 1
Click to Show/Hide the 6 Disease of This Class
HIV [ICD-11: 1C60-1C62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue White matter
The Specific Disease HIV
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.548930309; Fold-change: 0.106617898; Z-score: 0.382451641
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Influenza [ICD-11: 1E30]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Influenza
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011665688; Fold-change: 0.326044126; Z-score: 2.871157296
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic hepatitis C [ICD-11: 1E51.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Chronic hepatitis C
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.043651211; Fold-change: 0.063488127; Z-score: 0.502363775
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sepsis [ICD-11: 1G40-1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Sepsis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.015272871; Fold-change: -0.042890004; Z-score: -0.167782771
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Septic shock [ICD-11: 1G41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Septic shock
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.295255058; Fold-change: 0.016558897; Z-score: 0.05912058
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Pediatric respiratory syncytial virus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.01858274; Fold-change: -0.090067774; Z-score: -0.524013021
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 11
Click to Show/Hide the 6 Disease of This Class
Essential hypertension [ICD-11: BA00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Essential hypertension
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.525866214; Fold-change: 0.318675294; Z-score: 2.650634137
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myocardial infarction [ICD-11: BA41]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Myocardial infarction
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.014114323; Fold-change: 0.154845982; Z-score: 0.456973753
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Coronary artery disease [ICD-11: BA8Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Coronary artery disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.673834691; Fold-change: -0.035753603; Z-score: -0.223525435
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aortic stenosis [ICD-11: BB70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Calcified aortic valve
The Specific Disease Aortic stenosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.989536716; Fold-change: 0.096603436; Z-score: 0.215719044
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arteriosclerosis [ICD-11: BD40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arteriosclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.876298656; Fold-change: -0.099654558; Z-score: -0.342512126
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Aneurysm [ICD-11: BD50]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Intracranial artery
The Specific Disease Aneurysm
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.532959484; Fold-change: -0.045108287; Z-score: -0.135640979
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 12
Click to Show/Hide the 8 Disease of This Class
Immunodeficiency [ICD-11: 4A00-4A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Immunodeficiency
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.208309732; Fold-change: -0.062799691; Z-score: -0.512493447
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Apnea [ICD-11: 7A40]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Hyperplastic tonsil
The Specific Disease Apnea
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.013286944; Fold-change: 1.051265234; Z-score: 3.431746793
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Olive pollen allergy [ICD-11: CA08.00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Olive pollen allergy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.025632206; Fold-change: 0.276666645; Z-score: 1.559648542
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic rhinosinusitis [ICD-11: CA0A]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Sinus mucosa
The Specific Disease Chronic rhinosinusitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.570803912; Fold-change: 0.010050006; Z-score: 0.060622329
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Chronic obstructive pulmonary disease [ICD-11: CA22]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.44354509; Fold-change: 0.02066444; Z-score: 0.068868724
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Small airway epithelium
The Specific Disease Chronic obstructive pulmonary disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.003378137; Fold-change: 0.139438344; Z-score: 0.532929535
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Asthma [ICD-11: CA23]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal and bronchial airway
The Specific Disease Asthma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.00011918; Fold-change: -0.19632418; Z-score: -0.27582978
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Human rhinovirus infection [ICD-11: CA42]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Nasal Epithelium
The Specific Disease Human rhinovirus infection
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.44129707; Fold-change: 0.014697739; Z-score: 0.096192409
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Lung
The Specific Disease Idiopathic pulmonary fibrosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.007507484; Fold-change: -0.142660044; Z-score: -1.732801035
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 13
Click to Show/Hide the 5 Disease of This Class
Periodontal disease [ICD-11: DA0C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gingival
The Specific Disease Periodontal disease
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 1.05E-10; Fold-change: 0.458306154; Z-score: 1.158688753
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Eosinophilic gastritis [ICD-11: DA42.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Gastric antrum
The Specific Disease Eosinophilic gastritis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.550487479; Fold-change: 0.046535421; Z-score: 0.363782409
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Liver failure [ICD-11: DB99.7-DB99.8]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Liver failure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.031946362; Fold-change: 0.217753934; Z-score: 1.232970869
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ulcerative colitis [ICD-11: DD71]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Colon mucosal
The Specific Disease Ulcerative colitis
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.022993836; Fold-change: 0.263846485; Z-score: 0.466086231
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Irritable bowel syndrome [ICD-11: DD91.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Irritable bowel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.999947689; Fold-change: 0.022853526; Z-score: 0.08718622
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 14
Click to Show/Hide the 5 Disease of This Class
Atopic dermatitis [ICD-11: EA80]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Atopic dermatitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.042131563; Fold-change: 0.106429442; Z-score: 0.824559864
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Psoriasis [ICD-11: EA90]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Psoriasis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 3.23E-08; Fold-change: 0.194441091; Z-score: 0.703325587
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.003499996; Fold-change: -0.094343021; Z-score: -0.321956772
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Vitiligo [ICD-11: ED63.0]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Vitiligo
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.757385469; Fold-change: -0.067364245; Z-score: -0.601639941
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alopecia [ICD-11: ED70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin from scalp
The Specific Disease Alopecia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.075285466; Fold-change: -0.12915381; Z-score: -0.281406504
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sensitive skin [ICD-11: EK0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Sensitive skin
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.604059359; Fold-change: 0.09027502; Z-score: 0.474517127
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 15
Click to Show/Hide the 6 Disease of This Class
Osteoarthritis [ICD-11: FA00-FA0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Osteoarthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.071826265; Fold-change: -0.296895578; Z-score: -0.823466469
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthropathy [ICD-11: FA00-FA5Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthropathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.717220936; Fold-change: 0.000512628; Z-score: 0.005089626
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.008201233; Fold-change: 0.079136839; Z-score: 0.219650727
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rheumatoid arthritis [ICD-11: FA20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Synovial
The Specific Disease Rheumatoid arthritis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.078121164; Fold-change: -0.113859293; Z-score: -0.281278752
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ankylosing spondylitis [ICD-11: FA92.0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Pheripheral blood
The Specific Disease Ankylosing spondylitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.287663387; Fold-change: -0.056145135; Z-score: -0.421605028
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Osteoporosis [ICD-11: FB83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Osteoporosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.811925883; Fold-change: -0.150077522; Z-score: -0.461521224
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 16
Click to Show/Hide the 2 Disease of This Class
Endometriosis [ICD-11: GA10]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Endometrium
The Specific Disease Endometriosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.676114927; Fold-change: 0.068458532; Z-score: 0.223678224
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Interstitial cystitis [ICD-11: GC00.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bladder
The Specific Disease Interstitial cystitis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.028130444; Fold-change: 0.196394768; Z-score: 2.607668863
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 19
Click to Show/Hide the 1 Disease of This Class
Preterm birth [ICD-11: KA21.4Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Myometrium
The Specific Disease Preterm birth
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.531771291; Fold-change: 0.186716373; Z-score: 0.705746707
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 2
Click to Show/Hide the 8 Disease of This Class
Acute myelocytic leukemia [ICD-11: 2A60]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Acute myelocytic leukemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.06865531; Fold-change: 0.018494561; Z-score: 0.092008774
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myeloma [ICD-11: 2A83]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.000368365; Fold-change: -0.563704208; Z-score: -2.084758525
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Peripheral blood
The Specific Disease Myeloma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.928840913; Fold-change: 0.134474098; Z-score: 0.494851378
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Oral cancer [ICD-11: 2B6E]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Oral
The Specific Disease Oral cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 6.04E-06; Fold-change: -0.442781985; Z-score: -0.944426185
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.003745103; Fold-change: -0.100727977; Z-score: -0.26383415
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Esophagal cancer [ICD-11: 2B70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Esophagus
The Specific Disease Esophagal cancer
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.871969835; Fold-change: 0.027120916; Z-score: 0.094415349
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Rectal cancer [ICD-11: 2B92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Rectal colon
The Specific Disease Rectal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.481282335; Fold-change: -0.214252583; Z-score: -0.692876715
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.008924235; Fold-change: -0.439756841; Z-score: -1.738917758
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Skin cancer [ICD-11: 2C30-2C3Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Skin cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.619147597; Fold-change: -0.099606712; Z-score: -0.350486501
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.553255979; Fold-change: -0.165454648; Z-score: -0.384365165
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Renal cancer [ICD-11: 2C90-2C91]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Kidney
The Specific Disease Renal cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.253572141; Fold-change: 0.088452912; Z-score: 0.553394842
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.013651375; Fold-change: 0.200255308; Z-score: 0.5589123
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Ureter cancer [ICD-11: 2C92]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Urothelium
The Specific Disease Ureter cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.755741753; Fold-change: 0.095902617; Z-score: 0.315700578
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 20
Click to Show/Hide the 2 Disease of This Class
Simpson golabi behmel syndrome [ICD-11: LD2C]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Adipose
The Specific Disease Simpson golabi behmel syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.809433931; Fold-change: 0.189092605; Z-score: 0.785272607
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Tuberous sclerosis complex [ICD-11: LD2D.2]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Perituberal
The Specific Disease Tuberous sclerosis complex
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.941685323; Fold-change: 0.156025291; Z-score: 0.575409091
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 3
Click to Show/Hide the 3 Disease of This Class
Anemia [ICD-11: 3A00-3A9Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Bone marrow
The Specific Disease Anemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.203899439; Fold-change: 0.423252154; Z-score: 1.121500453
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Sickle cell disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.887374175; Fold-change: -0.042197892; Z-score: -0.151976445
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Thrombocythemia [ICD-11: 3B63]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Thrombocythemia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.039831538; Fold-change: 0.003176004; Z-score: 0.022916037
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 4
Click to Show/Hide the 4 Disease of This Class
Scleroderma [ICD-11: 4A42.Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Scleroderma
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.011282788; Fold-change: -0.227666593; Z-score: -1.327668538
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Sjogren syndrome [ICD-11: 4A43]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Salivary gland
The Specific Disease Sjogren syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.119501004; Fold-change: -0.151715451; Z-score: -1.649799683
The Expression Level of Disease Section Compare with the Adjacent Tissue p-value: 0.3898752; Fold-change: -0.176335944; Z-score: -1.108069764
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Behcet disease [ICD-11: 4A62]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Peripheral blood
The Specific Disease Behcet disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.115917237; Fold-change: 0.042902074; Z-score: 0.139954669
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Autosomal dominant monocytopenia [ICD-11: 4B04]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autosomal dominant monocytopenia
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.115013343; Fold-change: -0.1852026; Z-score: -1.258161763
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 5
Click to Show/Hide the 5 Disease of This Class
Type 2 diabetes [ICD-11: 5A11]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Liver
The Specific Disease Type 2 diabetes
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.837501343; Fold-change: -0.002994157; Z-score: -0.011607048
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Polycystic ovary syndrome [ICD-11: 5A80.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Vastus lateralis muscle
The Specific Disease Polycystic ovary syndrome
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.16494638; Fold-change: 0.174586556; Z-score: 0.419158209
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Obesity [ICD-11: 5B81]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Subcutaneous Adipose
The Specific Disease Obesity
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.923604938; Fold-change: 0.028858779; Z-score: 0.22606775
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Pompe disease [ICD-11: 5C51.3]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Biceps muscle
The Specific Disease Pompe disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.17962363; Fold-change: -0.11307717; Z-score: -0.706571396
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Batten disease [ICD-11: 5C56.1]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Batten disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.540184752; Fold-change: -0.040825674; Z-score: -0.444831161
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 6
Click to Show/Hide the 2 Disease of This Class
Autism [ICD-11: 6A02]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Autism
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.086064417; Fold-change: -0.115258865; Z-score: -0.480224838
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Anxiety disorder [ICD-11: 6B00-6B0Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Anxiety disorder
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.181300993; Fold-change: 0.051755609; Z-score: 0.180877174
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
ICD Disease Classification 8
Click to Show/Hide the 7 Disease of This Class
Parkinson disease [ICD-11: 8A00]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Substantia nigra
The Specific Disease Parkinson disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.483528762; Fold-change: -0.096988613; Z-score: -0.355013914
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Huntington disease [ICD-11: 8A01]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Huntington disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.311671759; Fold-change: 0.030067811; Z-score: 0.123646511
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Alzheimer disease [ICD-11: 8A20]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Entorhinal cortex
The Specific Disease Alzheimer disease
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.608331562; Fold-change: -0.024648672; Z-score: -0.12987646
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Seizure [ICD-11: 8A60-8A6Z]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Whole blood
The Specific Disease Seizure
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.429578433; Fold-change: 0.183612353; Z-score: 0.867392
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Lateral sclerosis [ICD-11: 8B60.4]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Skin
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.723427467; Fold-change: 0.139734174; Z-score: 0.484571058
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
The Studied Tissue Cervical spinal cord
The Specific Disease Lateral sclerosis
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.980186858; Fold-change: 0.011008198; Z-score: 0.048269879
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Muscular atrophy [ICD-11: 8C70]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Muscular atrophy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 1.81E-09; Fold-change: -0.73101655; Z-score: -3.476766969
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
Myopathy [ICD-11: 8C70.6]
Click to Show/Hide
Differential expression pattern of antigen in diseases
The Studied Tissue Muscle
The Specific Disease Myopathy
The Expression Level of Disease Section Compare with the Healthy Individual Tissue p-value: 0.001953997; Fold-change: -0.159110784; Z-score: -1.525325452
Disease-specific Antigen Abundances Click to View the Clearer Original Diagram
References
Ref 1 Linkers for use in antibody drug conjugates; 2023-03-16.
Ref 2 A Phase I Study of the Anti-CD79b THIOMABTM-Drug Conjugate DCDS0780A in Patients (pts) with Relapsed or Refractory B-Cell Non-Hodgkin's Lymphoma (B-NHL). Blood. 2017;130(S1): 4129. doi: 10.1182/blood.V130.Suppl_1.4129.4129.
Ref 3 Polatuzumab vedotin plus bendamustine and rituximab in relapsed/refractory DLBCL: survival update and new extension cohort data. Blood Adv. 2022 Jan 25;6(2):533-543.
Ref 4 Introduction to basic information on ADC drug SHR-A1912.
Ref 5 NewBio Therapeutics company product pipeline
Ref 6 A CD79b Targeting ADC with Superior Anti-Tumor Activity and Safety Resulting in Significantly Improved Therapeutic Index (TI): Safe and Efficacious CD79b ADC. Blood. 2022 ;140():11568-11569. doi: 10.1182/blood-2022-160056.
Ref 7 Introduction to basic information on POZ-polymer ADCs.