General Information of This Antibody (ID: ANI0QYT100)
Antibody Name
SHR-1920
Organization
Jiangsu Hengrui Pharmaceuticals Co., Ltd.; Shanghai Hengrui Pharmaceutical Co., Ltd.
Synonyms
SHR-1920
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
B-cell antigen receptor complex-associated protein beta chain (CD79B)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
EVQLVQSGAEVKKPGSSVKVSCKASGSSFSSYGINWVKQAPGQGLEWIGEIFPRSGNTYY
NEKFEGRATLTADKSTSTAYMELRSLRSEDTAVYYCARGDLGDFDYWGQGTTVTVSSAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Light Chain Sequence
DIVMTQTPLSLPVTPGEPASISCRSSQSIVHSDGNTYLEWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPLTFGGGTKVEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
SHR-A1912 [Phase 3]
Identified from the Human Clinical Data
Click To Hide/Show 8 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data stable disease (SD)
7%
Patients Enrolled
Eligible patients (≥18 yrs) have confirmed relapsed/refractory B-cell lymphoma, ≥1 measurable lesion (nodal >1.5 cm/extranodal >1.0 cm), ECOG 0-1, and life expectancy >12 weeks. Exclusions: recent stem cell/CAR-T therapy (≤12 weeks), major surgery (≤4 weeks), anti-tumor treatment (≤2 weeks), CNS involvement, active HBV/HCV/HIV, uncontrolled infections, or severe cardiovascular disease.

   Click to Show/Hide
Administration Dosage
SHR-A1912, dose escalation and expansion.
Related Clinical Trial
NCT Number NCT05113069  Clinical Status PHASE1
Clinical Description
A Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-A1912 for Injection as Monotherapy in Patients With B-cell Lymphoma
Primary Endpoint
The study evaluates AEs and DLT within the first 21 days after initial dosing to determine MTD and establish RP2D (up to ~2 years). Safety monitoring continues through all treatment cycles.
Other Endpoint
harmacokinetics (Tmax, Cmax, AUC) of SHR-1912 and ADA formation are assessed within 21 days post-last dose. Efficacy outcomes (CR, ORR, DoR, DCR, PFS) are tracked for ~2 years, with OS extending to ~3 years. AEs are monitored for 12 weeks after treatment cessation.
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data progressive disease (PD)
11%
Patients Enrolled
Eligible patients (≥18 yrs) have confirmed relapsed/refractory B-cell lymphoma, ≥1 measurable lesion (nodal >1.5 cm/extranodal >1.0 cm), ECOG 0-1, and life expectancy >12 weeks. Exclusions: recent stem cell/CAR-T therapy (≤12 weeks), major surgery (≤4 weeks), anti-tumor treatment (≤2 weeks), CNS involvement, active HBV/HCV/HIV, uncontrolled infections, or severe cardiovascular disease.

   Click to Show/Hide
Administration Dosage
SHR-A1912, dose escalation and expansion.
Related Clinical Trial
NCT Number NCT05113069  Clinical Status PHASE1
Clinical Description
A Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-A1912 for Injection as Monotherapy in Patients With B-cell Lymphoma
Primary Endpoint
The study evaluates AEs and DLT within the first 21 days after initial dosing to determine MTD and establish RP2D (up to ~2 years). Safety monitoring continues through all treatment cycles.
Other Endpoint
harmacokinetics (Tmax, Cmax, AUC) of SHR-1912 and ADA formation are assessed within 21 days post-last dose. Efficacy outcomes (CR, ORR, DoR, DCR, PFS) are tracked for ~2 years, with OS extending to ~3 years. AEs are monitored for 12 weeks after treatment cessation.
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Partial Response (PR)
19%
Patients Enrolled
Eligible patients (≥18 yrs) have confirmed relapsed/refractory B-cell lymphoma, ≥1 measurable lesion (nodal >1.5 cm/extranodal >1.0 cm), ECOG 0-1, and life expectancy >12 weeks. Exclusions: recent stem cell/CAR-T therapy (≤12 weeks), major surgery (≤4 weeks), anti-tumor treatment (≤2 weeks), CNS involvement, active HBV/HCV/HIV, uncontrolled infections, or severe cardiovascular disease.

   Click to Show/Hide
Administration Dosage
SHR-A1912, dose escalation and expansion.
Related Clinical Trial
NCT Number NCT05113069  Clinical Status PHASE1
Clinical Description
A Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-A1912 for Injection as Monotherapy in Patients With B-cell Lymphoma
Primary Endpoint
The study evaluates AEs and DLT within the first 21 days after initial dosing to determine MTD and establish RP2D (up to ~2 years). Safety monitoring continues through all treatment cycles.
Other Endpoint
harmacokinetics (Tmax, Cmax, AUC) of SHR-1912 and ADA formation are assessed within 21 days post-last dose. Efficacy outcomes (CR, ORR, DoR, DCR, PFS) are tracked for ~2 years, with OS extending to ~3 years. AEs are monitored for 12 weeks after treatment cessation.
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Objective Response Rate (ORR)
56.10%
Patients Enrolled
Eligible patients (≥18 yrs) have confirmed relapsed/refractory B-cell lymphoma, ≥1 measurable lesion (nodal >1.5 cm/extranodal >1.0 cm), ECOG 0-1, and life expectancy >12 weeks. Exclusions: recent stem cell/CAR-T therapy (≤12 weeks), major surgery (≤4 weeks), anti-tumor treatment (≤2 weeks), CNS involvement, active HBV/HCV/HIV, uncontrolled infections, or severe cardiovascular disease.

   Click to Show/Hide
Administration Dosage
SHR-A1912, dose escalation and expansion.
Related Clinical Trial
NCT Number NCT05113069  Clinical Status PHASE1
Clinical Description
A Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-A1912 for Injection as Monotherapy in Patients With B-cell Lymphoma
Primary Endpoint
The study evaluates AEs and DLT within the first 21 days after initial dosing to determine MTD and establish RP2D (up to ~2 years). Safety monitoring continues through all treatment cycles.
Other Endpoint
harmacokinetics (Tmax, Cmax, AUC) of SHR-1912 and ADA formation are assessed within 21 days post-last dose. Efficacy outcomes (CR, ORR, DoR, DCR, PFS) are tracked for ~2 years, with OS extending to ~3 years. AEs are monitored for 12 weeks after treatment cessation.
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Disease control rate (DCR)
73.20%
Patients Enrolled
Eligible patients (≥18 yrs) have confirmed relapsed/refractory B-cell lymphoma, ≥1 measurable lesion (nodal >1.5 cm/extranodal >1.0 cm), ECOG 0-1, and life expectancy >12 weeks. Exclusions: recent stem cell/CAR-T therapy (≤12 weeks), major surgery (≤4 weeks), anti-tumor treatment (≤2 weeks), CNS involvement, active HBV/HCV/HIV, uncontrolled infections, or severe cardiovascular disease.

   Click to Show/Hide
Administration Dosage
SHR-A1912, dose escalation and expansion.
Related Clinical Trial
NCT Number NCT05113069  Clinical Status PHASE1
Clinical Description
A Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-A1912 for Injection as Monotherapy in Patients With B-cell Lymphoma
Primary Endpoint
The study evaluates AEs and DLT within the first 21 days after initial dosing to determine MTD and establish RP2D (up to ~2 years). Safety monitoring continues through all treatment cycles.
Other Endpoint
harmacokinetics (Tmax, Cmax, AUC) of SHR-1912 and ADA formation are assessed within 21 days post-last dose. Efficacy outcomes (CR, ORR, DoR, DCR, PFS) are tracked for ~2 years, with OS extending to ~3 years. AEs are monitored for 12 weeks after treatment cessation.
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Complete response (CR)
4%
Patients Enrolled
Eligible patients (≥18 yrs) have confirmed relapsed/refractory B-cell lymphoma, ≥1 measurable lesion (nodal >1.5 cm/extranodal >1.0 cm), ECOG 0-1, and life expectancy >12 weeks. Exclusions: recent stem cell/CAR-T therapy (≤12 weeks), major surgery (≤4 weeks), anti-tumor treatment (≤2 weeks), CNS involvement, active HBV/HCV/HIV, uncontrolled infections, or severe cardiovascular disease.

   Click to Show/Hide
Administration Dosage
SHR-A1912, dose escalation and expansion.
Related Clinical Trial
NCT Number NCT05113069  Clinical Status PHASE1
Clinical Description
A Phase I Clinical Study to Evaluate the Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-A1912 for Injection as Monotherapy in Patients With B-cell Lymphoma
Primary Endpoint
The study evaluates AEs and DLT within the first 21 days after initial dosing to determine MTD and establish RP2D (up to ~2 years). Safety monitoring continues through all treatment cycles.
Other Endpoint
harmacokinetics (Tmax, Cmax, AUC) of SHR-1912 and ADA formation are assessed within 21 days post-last dose. Efficacy outcomes (CR, ORR, DoR, DCR, PFS) are tracked for ~2 years, with OS extending to ~3 years. AEs are monitored for 12 weeks after treatment cessation.
Experiment 7 Reporting the Activity Date of This ADC [2]
Patients Enrolled
Eligible patients (≥18 yrs) include relapsed/refractory or treatment-naive B-cell NHL cases (≥1 measurable lesion: nodal >1.5cm/extranodal >1.0cm), ECOG 0-1, life expectancy >3 months. Exclusions: recent stem cell/CAR-T therapy (≤12 weeks), major surgery (≤4 weeks), active HBV/HCV/HIV, uncontrolled infections, or severe cardiovascular/CNS involvement.

   Click to Show/Hide
Related Clinical Trial
NCT Number NCT06104553  Clinical Status PHASE1|||PHASE2
Clinical Description
A Phase Ib/II Study of SHR-A1912 Combined With Other Therapies in Patients With B-cell Non-Hodgkin 's Lymphoma
Primary Endpoint
Phase 1b evaluates RP2D for SHR-A1912 combined with immunochemotherapy (selected within ~12 months) while assessing AEs up to ~24 months. Phase 2 focuses on ORR with ~24-month follow-up, with ongoing safety monitoring.
Other Endpoint
Both phases measure efficacy (ORR, CRR, DOR, PFS in Phase 1b/2) and pharmacokinetics (toxin-binding/total antibodies, free toxin, ADA) over ~24 months. Safety (AE incidence/severity) and immunogenicity are studied through the follow-up period in both cohorts.
Experiment 8 Reporting the Activity Date of This ADC [3]
Related Clinical Trial
NCT Number NCT05113069  Clinical Status Phase 1
Clinical Description
An open-label, single-arm, multicenter, phase 1 study to estimate the safety, tolerability, pharmacokinetics, and efficacy of SHR-A1912 in patients with b-cell lymphoma.
References
Ref 1 A Study of SHR-A1912 for Injection in Patients With B Cell Lymphomas
Ref 2 A Trial of SHR-A1912 Combined With Other Therapies in B-cell Non-Hodgkin 's Lymphoma
Ref 3 An Open-Label, Single-Arm, Multicenter, Phase I Study to Estimate the Safety, Tolerability, Pharmacokinetics, and Efficacy of SHR-A1912 in Patients With B-cell Lymphoma