Antigen Information
General Information of This Antigen
Antigen ID | TAR0GVYZS |
|||||
---|---|---|---|---|---|---|
Antigen Name | Fibroblast growth factor receptor 4 (FGFR4) |
|||||
Gene Name | FGFR4 |
|||||
Gene ID | ||||||
Synonym | JTK2; TKF; CD_antigen=CD334 |
|||||
Sequence |
MRLLLALLGVLLSVPGPPVLSLEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRA
ERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDS LTSSNDDEDPKSHRDPSNRHSYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTP TIRWLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENAVGSIRYNYLLD VLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHIVINGSSFGADGFP YVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDPTWTA AAPEARYTDIILYASGSLALAVLLLLAGLYRGQALHGRHPRPPATVQKLSRFPLARQFSL ESGSSGKSSSSLVRGVRLSSSGPALLAGLVSLDLPLDPLWEFPRDRLVLGKPLGEGCFGQ VVRAEAFGMDPARPDQASTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVC TQEGPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPVLVSCAYQVARGM QYLESRKCIHRDLAARNVLVTEDNVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEA LFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMDRPPHCPPELYG LMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPYSPSGGDASSTCSSSDS VFSHDPLPLGSSSFPFGSGVQT Click to Show/Hide
|
|||||
Family | Tyr protein family |
|||||
Function |
Tyrosine-protein kinase that acts as cell-surface receptor for fibroblast growth factors and plays a role in the regulation of cell proliferation, differentiation and migration, and in regulation of lipid metabolism, bile acid biosynthesis, glucose uptake, vitamin D metabolism and phosphate homeostasis. Required for normal down- regulation of the expression of CYP7A1, the rate-limiting enzyme in bile acid synthesis, in response to FGF19. Phosphorylates PLCG1 and FRS2. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. Phosphorylation of FRS2 triggers recruitment of GRB2, GAB1, PIK3R1 and SOS1, and mediates activation of RAS, MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Promotes SRC-dependent phosphorylation of the matrix protease MMP14 and its lysosomal degradation. FGFR4 signaling is down-regulated by receptor internalization and degradation; MMP14 promotes internalization and degradation of FGFR4. Mutations that lead to constitutive kinase activation or impair normal FGFR4 inactivation lead to aberrant signaling.
Click to Show/Hide
|
|||||
Uniprot Entry | ||||||
HGNC ID | ||||||
KEGG ID |
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
Tissue/Disease specific Abundances of This Antigen
Tissue specific Abundances of This Antigen
ICD Disease Classification 01
Bacterial infection [ICD-11: 1A00-1C4Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Bacterial infection of gingival | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.324896255; Fold-change: -0.01638399; Z-score: -0.092340714 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 02
Brain cancer [ICD-11: 2A00]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Brainstem | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.684609001; Fold-change: -0.108444393; Z-score: -0.688704077 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | White matter | |
The Specific Disease | Glioma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011213117; Fold-change: -0.427690542; Z-score: -1.749960451 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Brainstem | |
The Specific Disease | Neuroectodermal tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.644007796; Fold-change: 0.097532832; Z-score: 0.317655481 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Nervous | |
The Specific Disease | Brain cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000469584; Fold-change: -0.063956982; Z-score: -0.335509371 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Chronic myeloid leukemia [ICD-11: 2A20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Polycythemia vera | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.082483527; Fold-change: 0.059270177; Z-score: 0.65039637 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Whole blood | |
The Specific Disease | Myelofibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.291750344; Fold-change: -0.066307664; Z-score: -0.713217024 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
MyeloDysplastic syndromes [ICD-11: 2A37]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myelodysplastic syndromes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.788947303; Fold-change: -0.068555386; Z-score: -0.378810385 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.124485531; Fold-change: -0.183181914; Z-score: -0.83798472 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Lymphoma [ICD-11: 2A90- 2A85]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Tonsil | |
The Specific Disease | Lymphoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.830859325; Fold-change: 0.071093825; Z-score: 0.35880064 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Gastric cancer [ICD-11: 2B72]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric | |
The Specific Disease | Gastric cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000369158; Fold-change: 0.50379297; Z-score: 7.861771969 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.43E-09; Fold-change: 0.578363712; Z-score: 2.336963114 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Colon cancer [ICD-11: 2B90]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon | |
The Specific Disease | Colon cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 7.96E-06; Fold-change: 0.151571311; Z-score: 0.494573665 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 2.08E-25; Fold-change: 0.351662219; Z-score: 1.356088794 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Pancreatic cancer [ICD-11: 2C10]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pancreas | |
The Specific Disease | Pancreatic cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.102092926; Fold-change: 0.207448653; Z-score: 0.494598634 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.132712614; Fold-change: -0.089714535; Z-score: -0.183138535 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Liver cancer [ICD-11: 2C12]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000206422; Fold-change: 0.18950596; Z-score: 0.556384868 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 1.25E-24; Fold-change: 0.561745332; Z-score: 1.297715334 | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.323527178; Fold-change: 0.135878918; Z-score: 0.388002656 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Lung cancer [ICD-11: 2C25]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Lung cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 5.27E-74; Fold-change: -1.297216239; Z-score: -2.391686002 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.96E-49; Fold-change: -1.514823973; Z-score: -2.393273404 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Melanoma [ICD-11: 2C30]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Melanoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.414775789; Fold-change: -0.032248217; Z-score: -0.10807278 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sarcoma [ICD-11: 2C35]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Sarcoma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 2.63E-78; Fold-change: -0.621629236; Z-score: -2.806720034 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.011004217; Fold-change: -0.45937382; Z-score: -3.582048398 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Breast cancer [ICD-11: 2C60]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Breast | |
The Specific Disease | Breast cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.61E-47; Fold-change: 0.284042109; Z-score: 1.009123229 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.27E-06; Fold-change: 0.397238551; Z-score: 0.840792643 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Ovarian cancer [ICD-11: 2C73]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Ovarian | |
The Specific Disease | Ovarian cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002129872; Fold-change: -0.93767661; Z-score: -1.86821137 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000249314; Fold-change: 0.248708502; Z-score: 1.069847429 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Cervical cancer [ICD-11: 2C77]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Cervical | |
The Specific Disease | Cervical cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.392398801; Fold-change: 0.091826669; Z-score: 0.569330233 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Uterine cancer [ICD-11: 2C78]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Uterine cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.00113636; Fold-change: -0.098631189; Z-score: -0.261738149 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.169828413; Fold-change: 0.144509437; Z-score: 0.70189661 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Prostate cancer [ICD-11: 2C82]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Prostate | |
The Specific Disease | Prostate cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.335629827; Fold-change: -0.1284249; Z-score: -0.472152284 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Bladder cancer [ICD-11: 2C94]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Bladder cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.168682285; Fold-change: 0.115471857; Z-score: 0.498974237 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Retina cancer [ICD-11: 2D02]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Uvea | |
The Specific Disease | Retinoblastoma tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.005105755; Fold-change: 0.15533669; Z-score: 1.38133257 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Thyroid cancer [ICD-11: 2D10]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Thyroid | |
The Specific Disease | Thyroid cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.023945112; Fold-change: 0.044639845; Z-score: 0.213682504 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000172005; Fold-change: 0.088984031; Z-score: 0.557124392 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Adrenal cancer [ICD-11: 2D11]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adrenal cortex | |
The Specific Disease | Adrenocortical carcinoma | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.00189852; Fold-change: 0.178223979; Z-score: 0.812436057 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Head and neck cancer [ICD-11: 2D42]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Head and neck | |
The Specific Disease | Head and neck cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.015586151; Fold-change: 0.046661847; Z-score: 0.252680186 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Pituitary cancer [ICD-11: 2F37]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary gonadotrope tumor | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.164911805; Fold-change: 0.09731206; Z-score: 0.439795113 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Pituitary | |
The Specific Disease | Pituitary cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.041566327; Fold-change: 0.225269183; Z-score: 0.744224823 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 03
Thrombocytopenia [ICD-11: 3B64]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocytopenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.473546666; Fold-change: 0.215669163; Z-score: 0.819713711 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 04
Lupus erythematosus [ICD-11: 4A40]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Lupus erythematosus | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.002455269; Fold-change: -0.092281705; Z-score: -0.296270159 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Autoimmune disease [ICD-11: 4A4Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral monocyte | |
The Specific Disease | Autoimmune uveitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.011744933; Fold-change: -0.29444948; Z-score: -2.356430334 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 05
Hyperlipoproteinaemia [ICD-11: 5C80]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Familial hypercholesterolemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.530980085; Fold-change: 0.055755974; Z-score: 0.275661438 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 06
Schizophrenia [ICD-11: 6A20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Superior temporal cortex | |
The Specific Disease | Schizophrenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.898977021; Fold-change: -0.005288011; Z-score: -0.056746174 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 08
Multiple sclerosis [ICD-11: 8A40]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Spinal cord | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.530247577; Fold-change: -0.125207431; Z-score: -0.62702038 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Plasmacytoid dendritic cells | |
The Specific Disease | Multiple sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.425621524; Fold-change: 0.110422922; Z-score: 0.501692113 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Epilepsy [ICD-11: 8A60]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peritumoral cortex | |
The Specific Disease | Epilepsy | |
The Expression Level of Disease Section Compare with the Other Disease Section | p-value: 0.087361275; Fold-change: 0.194897046; Z-score: 4.226830303 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Cerebral ischaemic stroke [ICD-11: 8B11]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Cardioembolic Stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.395389033; Fold-change: 0.082867455; Z-score: 0.575999645 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Ischemic stroke | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003391215; Fold-change: 0.156059183; Z-score: 1.330310278 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 1
HIV [ICD-11: 1C60-1C62]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | White matter | |
The Specific Disease | HIV | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.059611248; Fold-change: -0.067938285; Z-score: -0.467763072 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Influenza [ICD-11: 1E30]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Influenza | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.180613289; Fold-change: 0.259606587; Z-score: 7.319884624 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Chronic hepatitis C [ICD-11: 1E51.1]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Chronic hepatitis C | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.638434319; Fold-change: 0.012296599; Z-score: 0.086568211 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sepsis [ICD-11: 1G40-1G41]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Sepsis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.235954859; Fold-change: -0.045971749; Z-score: -0.172007402 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Septic shock [ICD-11: 1G41]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Septic shock | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.673199985; Fold-change: -0.016422803; Z-score: -0.059007325 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Pediatric respiratory syncytial virus infection [ICD-11: CA40.11]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Pediatric respiratory syncytial virus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000402042; Fold-change: -0.163331512; Z-score: -1.59724023 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 11
Essential hypertension [ICD-11: BA00]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Essential hypertension | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.440400906; Fold-change: 0.133705311; Z-score: 1.338329929 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Myocardial infarction [ICD-11: BA41]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myocardial infarction | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.024471449; Fold-change: 0.172524187; Z-score: 0.58734103 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Coronary artery disease [ICD-11: BA8Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Coronary artery disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.590767468; Fold-change: -0.058485273; Z-score: -0.259701034 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Aortic stenosis [ICD-11: BB70]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Calcified aortic valve | |
The Specific Disease | Aortic stenosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.684288556; Fold-change: 0.097506733; Z-score: 0.186235356 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Arteriosclerosis [ICD-11: BD40]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arteriosclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.45899931; Fold-change: 0.023172342; Z-score: 0.176084951 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Aneurysm [ICD-11: BD50]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Intracranial artery | |
The Specific Disease | Aneurysm | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.761601659; Fold-change: -0.126004446; Z-score: -0.654175556 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 12
Immunodeficiency [ICD-11: 4A00-4A20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Immunodeficiency | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.014581321; Fold-change: 0.108573757; Z-score: 1.426839078 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Apnea [ICD-11: 7A40]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Hyperplastic tonsil | |
The Specific Disease | Apnea | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.648254403; Fold-change: 0.088281635; Z-score: 0.576953494 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Olive pollen allergy [ICD-11: CA08.00]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Olive pollen allergy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.093573243; Fold-change: 0.258798251; Z-score: 1.339051458 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Chronic rhinosinusitis [ICD-11: CA0A]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Sinus mucosa | |
The Specific Disease | Chronic rhinosinusitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.383010013; Fold-change: -0.064662998; Z-score: -0.604332696 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Chronic obstructive pulmonary disease [ICD-11: CA22]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.022521478; Fold-change: -0.143380247; Z-score: -0.337925852 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Small airway epithelium | |
The Specific Disease | Chronic obstructive pulmonary disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.000454171; Fold-change: 0.153171323; Z-score: 0.808525686 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Asthma [ICD-11: CA23]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal and bronchial airway | |
The Specific Disease | Asthma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003256859; Fold-change: -0.085692215; Z-score: -0.384014289 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Human rhinovirus infection [ICD-11: CA42]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Nasal Epithelium | |
The Specific Disease | Human rhinovirus infection | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.097843604; Fold-change: -0.027787655; Z-score: -0.209440177 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Lung | |
The Specific Disease | Idiopathic pulmonary fibrosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.01193225; Fold-change: -0.661518972; Z-score: -2.827577313 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 13
Periodontal disease [ICD-11: DA0C]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gingival | |
The Specific Disease | Periodontal disease | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.935179543; Fold-change: 0.003316454; Z-score: 0.019582609 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Eosinophilic gastritis [ICD-11: DA42.2]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Gastric antrum | |
The Specific Disease | Eosinophilic gastritis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.112723057; Fold-change: 0.129421127; Z-score: 2.884068772 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Liver failure [ICD-11: DB99.7-DB99.8]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Liver failure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.141322709; Fold-change: -0.194597727; Z-score: -0.651853948 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Ulcerative colitis [ICD-11: DD71]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Colon mucosal | |
The Specific Disease | Ulcerative colitis | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.527750036; Fold-change: -0.030443806; Z-score: -0.134132657 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Irritable bowel syndrome [ICD-11: DD91.0]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Irritable bowel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.544905271; Fold-change: 0.018633996; Z-score: 0.097130526 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 14
Atopic dermatitis [ICD-11: EA80]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Atopic dermatitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.003775215; Fold-change: 0.073507247; Z-score: 0.538407832 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Psoriasis [ICD-11: EA90]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Psoriasis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.825605058; Fold-change: -0.011202342; Z-score: -0.041286591 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.286734625; Fold-change: -0.001692974; Z-score: -0.007762935 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Vitiligo [ICD-11: ED63.0]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Vitiligo | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.080527749; Fold-change: -0.082476429; Z-score: -0.632661509 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Alopecia [ICD-11: ED70]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin from scalp | |
The Specific Disease | Alopecia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.447327582; Fold-change: -0.013224164; Z-score: -0.071775268 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sensitive skin [ICD-11: EK0Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Sensitive skin | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.535508336; Fold-change: 0.062034701; Z-score: 0.432319551 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 15
Osteoarthritis [ICD-11: FA00-FA0Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Osteoarthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.127163943; Fold-change: -0.183676766; Z-score: -0.847928009 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Arthropathy [ICD-11: FA00-FA5Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthropathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.605602308; Fold-change: 0.000300088; Z-score: 0.003602074 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Arthritis [ICD-11: FA20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.053586643; Fold-change: 0.050553019; Z-score: 0.209658953 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Rheumatoid arthritis [ICD-11: FA20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Synovial | |
The Specific Disease | Rheumatoid arthritis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.013012801; Fold-change: -0.415842573; Z-score: -1.697073383 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Ankylosing spondylitis [ICD-11: FA92.0Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Pheripheral blood | |
The Specific Disease | Ankylosing spondylitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.999370974; Fold-change: 0.031395401; Z-score: 0.249945785 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Osteoporosis [ICD-11: FB83]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Osteoporosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.038813764; Fold-change: 0.128126709; Z-score: 3.426774415 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 16
Endometriosis [ICD-11: GA10]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Endometrium | |
The Specific Disease | Endometriosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.537627527; Fold-change: 0.043160641; Z-score: 0.195776375 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Interstitial cystitis [ICD-11: GC00.3]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bladder | |
The Specific Disease | Interstitial cystitis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.169412171; Fold-change: -0.142242008; Z-score: -0.425853119 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 19
Preterm birth [ICD-11: KA21.4Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Myometrium | |
The Specific Disease | Preterm birth | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.53745336; Fold-change: -0.13517374; Z-score: -0.428600681 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 2
Acute myelocytic leukemia [ICD-11: 2A60]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Acute myelocytic leukemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.15E-13; Fold-change: 0.214791493; Z-score: 1.034520713 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Myeloma [ICD-11: 2A83]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.76996937; Fold-change: -0.041811282; Z-score: -0.248035525 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Peripheral blood | |
The Specific Disease | Myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.47526227; Fold-change: -0.002854929; Z-score: -0.020022013 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Oral cancer [ICD-11: 2B6E]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Oral | |
The Specific Disease | Oral cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 9.10E-10; Fold-change: -0.343718121; Z-score: -1.895666015 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 7.90E-05; Fold-change: 0.115460807; Z-score: 0.554165524 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Esophagal cancer [ICD-11: 2B70]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Esophagus | |
The Specific Disease | Esophagal cancer | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.000440066; Fold-change: 0.385766217; Z-score: 2.103158751 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Rectal cancer [ICD-11: 2B92]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Rectal colon | |
The Specific Disease | Rectal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.012887137; Fold-change: 0.210418408; Z-score: 1.226779622 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 9.09E-06; Fold-change: 0.446014531; Z-score: 3.181149727 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Skin cancer [ICD-11: 2C30-2C3Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Skin cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.972025911; Fold-change: -0.002567086; Z-score: -0.009287738 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 3.47E-08; Fold-change: 0.104325227; Z-score: 0.412861602 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Renal cancer [ICD-11: 2C90-2C91]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Kidney | |
The Specific Disease | Renal cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.05284164; Fold-change: -0.324689678; Z-score: -0.836449687 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 4.58E-18; Fold-change: -0.401814666; Z-score: -1.346176722 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Ureter cancer [ICD-11: 2C92]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Urothelium | |
The Specific Disease | Ureter cancer | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.408263369; Fold-change: -0.024734002; Z-score: -0.166895719 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 20
Simpson golabi behmel syndrome [ICD-11: LD2C]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Adipose | |
The Specific Disease | Simpson golabi behmel syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.453567117; Fold-change: 0.038490155; Z-score: 0.357833059 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Tuberous sclerosis complex [ICD-11: LD2D.2]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Perituberal | |
The Specific Disease | Tuberous sclerosis complex | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.134863667; Fold-change: 0.168227392; Z-score: 1.707060072 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 3
Anemia [ICD-11: 3A00-3A9Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Bone marrow | |
The Specific Disease | Anemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.451093229; Fold-change: 0.132563256; Z-score: 0.805008578 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sickle cell disease [ICD-11: 3A51.0-3A51.3]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Sickle cell disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.115699232; Fold-change: 0.106614043; Z-score: 0.524114101 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Thrombocythemia [ICD-11: 3B63]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Thrombocythemia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.022400595; Fold-change: -0.001011533; Z-score: -0.010420325 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 4
Scleroderma [ICD-11: 4A42.Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Scleroderma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.342208523; Fold-change: 0.067501808; Z-score: 0.453750834 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Sjogren syndrome [ICD-11: 4A43]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Salivary gland | |
The Specific Disease | Sjogren syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.255147927; Fold-change: -0.186411163; Z-score: -0.856184299 | |
The Expression Level of Disease Section Compare with the Adjacent Tissue | p-value: 0.070083728; Fold-change: -0.243471932; Z-score: -1.264685739 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Behcet disease [ICD-11: 4A62]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Peripheral blood | |
The Specific Disease | Behcet disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.597518202; Fold-change: 0.012270401; Z-score: 0.083436576 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Autosomal dominant monocytopenia [ICD-11: 4B04]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autosomal dominant monocytopenia | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.115199448; Fold-change: -0.026027825; Z-score: -0.37349703 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 5
Type 2 diabetes [ICD-11: 5A11]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Liver | |
The Specific Disease | Type 2 diabetes | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.142730979; Fold-change: -0.230658848; Z-score: -0.828785831 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Polycystic ovary syndrome [ICD-11: 5A80.1]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Vastus lateralis muscle | |
The Specific Disease | Polycystic ovary syndrome | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.135509642; Fold-change: 0.054304047; Z-score: 0.3195232 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Obesity [ICD-11: 5B81]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Subcutaneous Adipose | |
The Specific Disease | Obesity | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.02489441; Fold-change: -0.051859439; Z-score: -0.393689413 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Pompe disease [ICD-11: 5C51.3]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Biceps muscle | |
The Specific Disease | Pompe disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.360944797; Fold-change: -0.073957271; Z-score: -0.540577922 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Batten disease [ICD-11: 5C56.1]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Batten disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.222282721; Fold-change: 0.093843692; Z-score: 0.876534136 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 6
Autism [ICD-11: 6A02]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Autism | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.877511708; Fold-change: -0.104456692; Z-score: -0.445256278 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Anxiety disorder [ICD-11: 6B00-6B0Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Anxiety disorder | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.314083108; Fold-change: 0.037209024; Z-score: 0.21096469 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
ICD Disease Classification 8
Parkinson disease [ICD-11: 8A00]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Substantia nigra | |
The Specific Disease | Parkinson disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.093873906; Fold-change: -0.120944593; Z-score: -1.161319603 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Huntington disease [ICD-11: 8A01]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Huntington disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.778860103; Fold-change: 0.040502837; Z-score: 0.213002887 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Alzheimer disease [ICD-11: 8A20]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Entorhinal cortex | |
The Specific Disease | Alzheimer disease | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.378585669; Fold-change: 0.000421723; Z-score: 0.003224219 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Seizure [ICD-11: 8A60-8A6Z]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Whole blood | |
The Specific Disease | Seizure | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.543458472; Fold-change: 0.042756478; Z-score: 0.333626703 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Lateral sclerosis [ICD-11: 8B60.4]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Skin | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.492949454; Fold-change: 0.088963835; Z-score: 0.461111241 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Cervical spinal cord | |
The Specific Disease | Lateral sclerosis | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.413410808; Fold-change: 0.056039288; Z-score: 0.552917208 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Muscular atrophy [ICD-11: 8C70]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Muscular atrophy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.70E-08; Fold-change: 0.612250295; Z-score: 2.621394963 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
Myopathy [ICD-11: 8C70.6]
Differential expression pattern of antigen in diseases | ||
The Studied Tissue | Muscle | |
The Specific Disease | Myopathy | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 0.774071597; Fold-change: 0.025182813; Z-score: 0.208743889 | |
Disease-specific Antigen Abundances | Click to View the Clearer Original Diagram | |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Shen et al.