Antigen Information
General Information of This Antigen
| Antigen ID | TAR0BSGNP |
|||||
|---|---|---|---|---|---|---|
| Antigen Name | Junctional adhesion molecule C (JAM3) |
|||||
| Gene Name | JAM3 |
|||||
| Gene ID | ||||||
| Synonym | JAM-2; Junctional adhesion molecule 3 |
|||||
| Sequence |
MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQT
SDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVAR NDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPL PTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDL NIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEG DFRHKSSFVI Click to Show/Hide
|
|||||
| Family | Immunoglobulin superfamily |
|||||
| Function |
Junctional adhesion protein that mediates heterotypic cell- cell interactions with its cognate receptor JAM2 to regulate different cellular processes. Plays a role in homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow. At the surface of bone marrow stromal cells, it contributes to the retention of the hematopoietic stem and progenitor cells expressing JAM3. Plays a central role in leukocytes extravasation by facilitating transmigration through the endothelium. Plays a role in spermatogenesis where JAM2 and JAM3, which are respectively expressed by Sertoli and germ cells, mediate an interaction between both cell types and play an essential role in the anchorage of germ cells onto Sertoli cells and the assembly of cell polarity complexes during spermatid differentiation. Also functions as a counter- receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN). Plays a role in angiogenesis. Plays a role in the regulation of cell migration (Probable). During myogenesis, it is involved in myocyte fusion. [Soluble form of JAM-C]: Promotes chemotaxis of vascular endothelial cells and stimulates angiogenesis.
Click to Show/Hide
|
|||||
| Uniprot Entry | ||||||
| HGNC ID | ||||||
| KEGG ID | ||||||
Each Antibody-drug Conjuate AND It's Component Related to This Antigen
Full List of The ADC Related to This Antigen
HSL156
| ADC Info | ADC Name | Payload | Target | Linker | Ref |
|---|---|---|---|---|---|
HSL156 mAb-DT3C conjugate |
Diphtheria toxin containing streptococcal protein G (DT3C) |
Eukaryotic elongation factor 2 kinase (EEF2K) |
Undisclosed |
[1] |
References
