Antibody Information
General Information of This Antibody
| Antibody ID | ANTI0ZSNDP |
|||||
|---|---|---|---|---|---|---|
| Antibody Name | mAb001c |
|||||
| Organization | Hefei Institutes of Physical Science |
|||||
| Synonyms |
mAb001c
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antigen Name | Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Varible Domain |
EVRLQQSGPVLVKPGASVKMSCKASGYTFTDYNLHWVKQSHRQSLEWIGYINPNHDGTSY
NQKFQGKATLTVDRSSSTAYMEFRSLTSEDSAVYYCARRVRTGTGLDDWGQGTTLTVSS Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
DYNLH
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
YINPNHDGTSYNQKFQG
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
RVRTGTGLDD
Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DVLMTQSPLSLPVSLGDQASISCRSSHNIVHTNGNTYLEWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTYFTLTISRVEAEDLGVYYCFQGSRFPYTFGGGTKLEIK Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
RSSHNIVHTNGNTYLE
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
KVSNRFS
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
FQGSRFPYT
Click to Show/Hide
|
|||||
The Activity Data of This Antibody
| Antibody Activity Information 1 | [1] | |||||
|
Half Maximal Effective Concentration (EC50)
|
0.15
|
nM
|
MDA-MBDMEM cells | CVCL_0062 | ||
|---|---|---|---|---|---|---|
| Antigen Expression | High ROR1 expression (ROR1+++) | |||||
| Antibody Function | mAb001c bound to MDA-MB-231 cells | |||||
| Antibody Antigen Binding Assay | Affinity (the EC50 value determined by ELISA is 0.012nM). In addition, the preferred antibody has a good binding affinity for ROR1 on the surface of tumor cells (the EC50 value determined by FACS is 0.15 nM - 1.1 nM), and can be used as a therapeutic antibody targeting ROR1. | |||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
mAb001c-vc-MMAE [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 10 nM | High ROR1 expression (ROR1+++);ROR1 MFI=79464.6 | ||
| Method Description |
A total of 250-1500cells (MDA-MB-231) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-231 cells | CVCL_0062 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 10 nM | High ROR1 expression (ROR1+++);ROR1 MFI=70456.2 | ||
| Method Description |
A total of 250-1500cells (NCI-N87) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Gastric tubular adenocarcinoma | NCI-N87 cells | CVCL_1603 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 10 nM | High ROR1 expression (ROR1+++);ROR1 MFI=97567.9 | ||
| Method Description |
A total of 250-1500cells (NCI-H446) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Lung small cell carcinoma | NCI-H446 cells | CVCL_1562 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 10 nM | High ROR1 expression (ROR1+++);ROR1 MFI=128559.5 | ||
| Method Description |
A total of 250-1500cells (HT-29) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Colon cancer | HT29 cells | CVCL_A8EZ | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 10 nM | High ROR1 expression (ROR1+++);ROR1 MFI=87015.2 | ||
| Method Description |
A total of 250-1500cells (HCC827) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | HCC827 cells | CVCL_2063 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | < 10 nM | High ROR1 expression (ROR1+++);ROR1 MFI=111495.8 | ||
| Method Description |
A total of 250-1500cells (HCC1187) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Breast ductal carcinoma | HCC1187 cells | CVCL_1247 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | Half Maximal inhibitory Concentration (lC50) | > 100 nM | Low ROR1 expression (ROR1+);ROR1 MFI=6610.4 | ||
| Method Description |
A total of 250-1500cells (MCF-7) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.
Click to Show/Hide
|
||||
| In Vitro Model | Invasive breast carcinoma | MCF-7 cells | CVCL_0031 | ||
References