General Information of This Antibody (ID: ANTI0ZSNDP)
Antibody Name
mAb001c
Organization
Hefei Institutes of Physical Science
Synonyms
mAb001c
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antigen Name
Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Varible Domain
EVRLQQSGPVLVKPGASVKMSCKASGYTFTDYNLHWVKQSHRQSLEWIGYINPNHDGTSY
NQKFQGKATLTVDRSSSTAYMEFRSLTSEDSAVYYCARRVRTGTGLDDWGQGTTLTVSS
    Click to Show/Hide
Heavy Chain CDR 1
DYNLH
    Click to Show/Hide
Heavy Chain CDR 2
YINPNHDGTSYNQKFQG
    Click to Show/Hide
Heavy Chain CDR 3
RVRTGTGLDD
    Click to Show/Hide
Light Chain Varible Domain
DVLMTQSPLSLPVSLGDQASISCRSSHNIVHTNGNTYLEWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTYFTLTISRVEAEDLGVYYCFQGSRFPYTFGGGTKLEIK
    Click to Show/Hide
Light Chain CDR 1
RSSHNIVHTNGNTYLE
    Click to Show/Hide
Light Chain CDR 2
KVSNRFS
    Click to Show/Hide
Light Chain CDR 3
FQGSRFPYT
    Click to Show/Hide
The Activity Data of This Antibody
Antibody Activity Information 1 [1]
Half Maximal Effective Concentration (EC50)
0.15
nM
MDA-MBDMEM cells CVCL_0062 
Antigen Expression High ROR1 expression (ROR1+++)
Antibody Function mAb001c bound to MDA-MB-231 cells
Antibody Antigen Binding Assay Affinity (the EC50 value determined by ELISA is 0.012nM). In addition, the preferred antibody has a good binding affinity for ROR1 on the surface of tumor cells (the EC50 value determined by FACS is 0.15 nM - 1.1 nM), and can be used as a therapeutic antibody targeting ROR1.
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
mAb001c-vc-MMAE [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 7 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) < 10 nM High ROR1 expression (ROR1+++);ROR1 MFI=79464.6
Method Description
A total of 250-1500cells (MDA-MB-231) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MB-231 cells CVCL_0062
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) < 10 nM High ROR1 expression (ROR1+++);ROR1 MFI=70456.2
Method Description
A total of 250-1500cells (NCI-N87) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) < 10 nM High ROR1 expression (ROR1+++);ROR1 MFI=97567.9
Method Description
A total of 250-1500cells (NCI-H446) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Lung small cell carcinoma NCI-H446 cells CVCL_1562
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) < 10 nM High ROR1 expression (ROR1+++);ROR1 MFI=128559.5
Method Description
A total of 250-1500cells (HT-29) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Colon cancer HT29 cells CVCL_A8EZ
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) < 10 nM High ROR1 expression (ROR1+++);ROR1 MFI=87015.2
Method Description
A total of 250-1500cells (HCC827) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma HCC827 cells CVCL_2063
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) < 10 nM High ROR1 expression (ROR1+++);ROR1 MFI=111495.8
Method Description
A total of 250-1500cells (HCC1187) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Breast ductal carcinoma HCC1187 cells CVCL_1247
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) > 100 nM Low ROR1 expression (ROR1+);ROR1 MFI=6610.4
Method Description
A total of 250-1500cells (MCF-7) were plated in 150ul cell culture medium per well of a 96-well flat plate in the appropriate growth media. After 3-5h, add ADC at different concentrations respectively. Set 2-4 replicate wells for each drug concentration, as well as corresponding vehicle control and blank control wells. After 5-6 days of treatment (according to the cell growth rate to ensure sufficient cell division), pour off the culture medium, add CCK8 reaction solution (purchased from MCE, cat#HY - K0301), 100 uL per well. Incubate at 37°C until the expected color intensity is reached, and measure the cell viability (OD450nm) of each group.

   Click to Show/Hide
In Vitro Model Invasive breast carcinoma MCF-7 cells CVCL_0031
References
Ref 1 Antibodies specifically binding ROR1, their drug conjugates, preparation methods and uses