Antibody Information
General Information of This Antibody (ID: ANTI0ZNTHI)
| Antibody Name | 2G10-5 |
|||||
|---|---|---|---|---|---|---|
| Organization | LIGACHEM BIOSCIENCES INC. |
|||||
| Synonyms |
2G10-5
Click to Show/Hide
|
|||||
| Antibody Type | Monoclonal antibody (mAb) |
|||||
| Antibody Subtype | Humanized lgG |
|||||
| Antigen Name | Tumor-associated calcium signal transducer 2 (TACSTD2) |
Antigen Info | ||||
| Click to Show/Hide the Sequence Information of This Antibody | ||||||
| Heavy Chain Sequence |
QVQLVQSGAEVKKPGASVKVSCKASGFTFSSSYISWLRQAPGQRLEWIAWIYAGTGGTSY
NQKFTGKATLTVDTSASTAYMELSSLRSEDTAVYYCARHNPRYYAMDYWGQGTTVTVSSA STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK Click to Show/Hide
|
|||||
| Heavy Chain Varible Domain |
QVQLVQSGAEVKKPGASVKVSCKASGFTFSSSYISWLRQAPGQRLEWIAWIYAGTGGTSY
NQKFTGKATLTVDTSASTAYMELSSLRSEDTAVYYCARHNPRYYAMDYWGQGTTVTVSS Click to Show/Hide
|
|||||
| Heavy Chain CDR 1 |
SSYIS
Click to Show/Hide
|
|||||
| Heavy Chain CDR 2 |
WIYAGTGGTSYNQKFTG
Click to Show/Hide
|
|||||
| Heavy Chain CDR 3 |
HNPRYYAMDY
Click to Show/Hide
|
|||||
| Light Chain Sequence |
DTQMTQSPSSLSASVGDRVTITCITSTDIDDDMNWYQKPGKAPKLLISEGNTRPGPSRFS
GSGYGTDFTFTISSLQPEDIATYYCLQSDNLPYTFGGGTKVEIKRTVAAPSVFIFPPSDE QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain Varible Domain |
DTQMTQSPSSLSASVGDRVTITCITSTDIDDDMNWYQQKPGKAPKLLISEGNTLRPGVPS
RFSGSGYGTDFTFTISSLQPEDIATYYCLQSDNLPYTFGGGTKVEIK Click to Show/Hide
|
|||||
| Light Chain Constant Domain |
DTQMTQSPSSLSASVGDRVTITCITSTDIDDDMNWYQQKPGKAPKLLISEGNTLRPGVPS
RFSGSGYGTDFTFTISSLQPEDIATYYCLQSDNLPYTFGGGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Click to Show/Hide
|
|||||
| Light Chain CDR 1 |
ITSTDIDDDMN
Click to Show/Hide
|
|||||
| Light Chain CDR 2 |
EGNTLRP
Click to Show/Hide
|
|||||
| Light Chain CDR 3 |
LQSDNLPYT
Click to Show/Hide
|
|||||
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
BR112024020733A2ADC2 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
0.148 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Gastric tubular adenocarcinoma | NCI-N87 cells | CVCL_1603 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
0.58 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
1.065 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Colon cancer | HT29 cells | CVCL_A8EZ | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
3.605 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Pancreatic ductal adenocarcinoma | BxPC-3 cells | CVCL_0186 | ||
BR112024020733A2ADC3 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
0.357 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Gastric tubular adenocarcinoma | NCI-N87 cells | CVCL_1603 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
5.435 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Colon cancer | HT29 cells | CVCL_A8EZ | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
11.54 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
53.68 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Pancreatic ductal adenocarcinoma | BxPC-3 cells | CVCL_0186 | ||
BR112024020733A2ADC1 [Investigative]
Revealed Based on the Cell Line Data
| Experiment 1 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
0.582 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Gastric tubular adenocarcinoma | NCI-N87 cells | CVCL_1603 | ||
| Experiment 2 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
1.412 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Pancreatic adenocarcinoma | Patu8988s cells | CVCL_1846 | ||
| Experiment 3 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
3.538 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Lung adenocarcinoma | Calu-3 cells | CVCL_0609 | ||
| Experiment 4 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
4.043 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Colon cancer | HT29 cells | CVCL_A8EZ | ||
| Experiment 5 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
4.639 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Pancreatic ductal adenocarcinoma | BxPC-3 cells | CVCL_0186 | ||
| Experiment 6 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
6.104 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Breast adenocarcinoma | MDA-MB-468 cells | CVCL_0419 | ||
| Experiment 7 Reporting the Activity Date of This ADC | [1] | ||||
| Efficacy Data | half-maximal cytotoxicity Concentration (CC50) |
18.06 nM
|
High TROP2 expression (TROP2 +++) | ||
| Method Description |
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.
Click to Show/Hide
|
||||
| In Vitro Model | Pancreatic ductal adenocarcinoma | Capan-1 cells | CVCL_0237 | ||
