General Information of This Antibody (ID: ANTI0ZNTHI)
Antibody Name
2G10-5
Organization
LIGACHEM BIOSCIENCES INC.
Synonyms
2G10-5
   Click to Show/Hide
Antibody Type
Monoclonal antibody (mAb)
Antibody Subtype
Humanized lgG
Antigen Name
Tumor-associated calcium signal transducer 2 (TACSTD2)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGFTFSSSYISWLRQAPGQRLEWIAWIYAGTGGTSY
NQKFTGKATLTVDTSASTAYMELSSLRSEDTAVYYCARHNPRYYAMDYWGQGTTVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
    Click to Show/Hide
Heavy Chain Varible Domain
QVQLVQSGAEVKKPGASVKVSCKASGFTFSSSYISWLRQAPGQRLEWIAWIYAGTGGTSY
NQKFTGKATLTVDTSASTAYMELSSLRSEDTAVYYCARHNPRYYAMDYWGQGTTVTVSS
    Click to Show/Hide
Heavy Chain CDR 1
SSYIS
    Click to Show/Hide
Heavy Chain CDR 2
WIYAGTGGTSYNQKFTG
    Click to Show/Hide
Heavy Chain CDR 3
HNPRYYAMDY
    Click to Show/Hide
Light Chain Sequence
DTQMTQSPSSLSASVGDRVTITCITSTDIDDDMNWYQKPGKAPKLLISEGNTRPGPSRFS
GSGYGTDFTFTISSLQPEDIATYYCLQSDNLPYTFGGGTKVEIKRTVAAPSVFIFPPSDE
QLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSK
ADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
DTQMTQSPSSLSASVGDRVTITCITSTDIDDDMNWYQQKPGKAPKLLISEGNTLRPGVPS
RFSGSGYGTDFTFTISSLQPEDIATYYCLQSDNLPYTFGGGTKVEIK
    Click to Show/Hide
Light Chain Constant Domain
DTQMTQSPSSLSASVGDRVTITCITSTDIDDDMNWYQQKPGKAPKLLISEGNTLRPGVPS
RFSGSGYGTDFTFTISSLQPEDIATYYCLQSDNLPYTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain CDR 1
ITSTDIDDDMN
    Click to Show/Hide
Light Chain CDR 2
EGNTLRP
    Click to Show/Hide
Light Chain CDR 3
LQSDNLPYT
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
BR112024020733A2ADC2 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
0.148 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
0.58 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
1.065 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Colon cancer HT29 cells CVCL_A8EZ
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
3.605 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
BR112024020733A2ADC3 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
0.357 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
5.435 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Colon cancer HT29 cells CVCL_A8EZ
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
11.54 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
53.68 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
BR112024020733A2ADC1 [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 7 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
0.582 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Gastric tubular adenocarcinoma NCI-N87 cells CVCL_1603
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
1.412 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Pancreatic adenocarcinoma Patu8988s cells CVCL_1846
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
3.538 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Lung adenocarcinoma Calu-3 cells CVCL_0609
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
4.043 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Colon cancer HT29 cells CVCL_A8EZ
Experiment 5 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
4.639 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Pancreatic ductal adenocarcinoma BxPC-3 cells CVCL_0186
Experiment 6 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
6.104 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Breast adenocarcinoma MDA-MB-468 cells CVCL_0419
Experiment 7 Reporting the Activity Date of This ADC [1]
Efficacy Data half-maximal cytotoxicity Concentration (CC50)
18.06 nM
High TROP2 expression (TROP2 +++)
Method Description
Specifically, human pancreatic cancer cell lines (BxPC - 3, Capan - 1 and PATU - 8988s), breast cancer cell lines (JIMT - 1 and MDA - MB - 468), gastric cancer cell lines (NCI - N87, SNU - 601 and SNU - 620), colon cancer cell lines (HCT15, HT29, DLD - 1, SW480 and COLO205), ovarian cancer cell lines (OVCAR - 3), prostate cancer cell lines (PC - 3 and LNCaP) and Non small cell lung cancer cell lines (NCI - H1781, HCC827, Calu - 1 and Calu - 3). Use MMAE in standalone drug form and SG2057 (cAS #: 260417-62-7, MedKooBiosciences) as PBD dimer included in the ADC prepared according to Example 3. Inoculate each cancer cell line from 500 cells/well to 5000 cells/well into a 96 well plate and culture for 24 hours, followed by treatment with concentrations ranging from 0.256pM to 100nM (5-fold continuous dilution) of ADC1, ADC2, and ADC3 produced according to Example 3, as well as individual drugs MMAE and SG2057. After 144 hours, the number of live cells was quantified using sulforhodamine B (SRB) dye or Cell titrer glo.

   Click to Show/Hide
In Vitro Model Pancreatic ductal adenocarcinoma Capan-1 cells CVCL_0237
References
Ref 1 Conjugate antibody-drug comprising human trop2 antibody and use of the same