General Information of This Antibody (ID: ANTI0ZEWRI)
Antibody Name
16D6
Organization
Pfizer Inc.
Synonyms
16D6
   Click to Show/Hide
Antigen Name
Interleukin-3 receptor subunit alpha (IL3RA)
 Antigen Info 
Click to Show/Hide the Sequence Information of This Antibody
Heavy Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFSLTNFDISWIRQPPGKGLEWLGVMWTGGGTNYN
SAFMSRLSISRDISKSQVSLKMSSLQTDDTAIYYCVRGDTYFFAMDYWGQGTSVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLOSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDRTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRELLQGST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPG
    Click to Show/Hide
Heavy Chain Varible Domain
QVQLKESGPGLVAPSOSLSITCTVSGFSLTNFDISWIRQPPGKGLEWLGVMWTGGGTNYN
SAFMSRLSISRDISKSQVSLKMSSLQTDDTAIYYCVRGDTYFFAMDYWGQGTSVTVSS
    Click to Show/Hide
Heavy Chain CDR 1
GFSLTNFDIS
    Click to Show/Hide
Heavy Chain CDR 2
VMWTGGGTNYNSAFMS
    Click to Show/Hide
Heavy Chain CDR 3
GDTYFFAMDY
    Click to Show/Hide
Light Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLSSGTRKNFLSWYQQKTGQSPKLLIYWASTR
GSGVPDRFTGSGSGTDFTLTISSVQTEDLAVYYCKQSYNLYTFGGGTKLEIKRTVAAPSV
FIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSL
SSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
    Click to Show/Hide
Light Chain Varible Domain
DIVMSOSPSSLAVSAGEKVTMSCKSSQSLLSSGTRKNFLSWYQQKTGQSPKLLIYWASTR
GSGVPDRFTGSGSGTDFTLTISSVQTEDLAVYYCKOSYNLYTFGGGTKLEIK
    Click to Show/Hide
Light Chain CDR 1
KSSQSLLSSGTRKNFLS
    Click to Show/Hide
Light Chain CDR 2
WASTRGS
    Click to Show/Hide
Light Chain CDR 3
KQSYNLYT
    Click to Show/Hide
Each Antibody-drug Conjugate Related to This Antibody
Full Information of The Activity Data of The ADC(s) Related to This Antibody
JP2024177330A5 16D6-CPI [Investigative]
Revealed Based on the Cell Line Data
Click To Hide/Show 4 Activity Data Related to This Level
Experiment 1 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.22 ng/mL
High CD123 expression (CD123+++)
Method Description
MOLM13 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.

   Click to Show/Hide
In Vitro Model Adult acute myeloid leukemia MOLM-13 cells CVCL_2119
Experiment 2 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.4 ng/mL
High CD123 expression (CD123+++)
Method Description
MV4-11 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.

   Click to Show/Hide
In Vitro Model Childhood acute monocytic leukemia MV4-11 cells CVCL_0064
Experiment 3 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50)
0.59 ng/mL
Moderate CD123 expression (CD123++)
Method Description
JVM3 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.

   Click to Show/Hide
In Vitro Model B-cell prolymphocytic leukemia JVM3 cells CVCL_1320
Experiment 4 Reporting the Activity Date of This ADC [1]
Efficacy Data Half Maximal inhibitory Concentration (lC50) > 105.34 ng/mL Negative CD123 expression (CD123-)
Method Description
HL60 cell line cells were incubated with ADC or control at the following doses: 100 ng/ml, 25 ng/ml, 6.25 ng/ml, 1.56 ng/ml, 0.39 ng/ml, 0.09 ng/ml, 0.024 ng/ml, 0.006 ng/ml, 0.002 ng/ml and 0.0004 ng/ml. for 96 hours. Cell viability was measured with CelltiterGlo (Promega, Madison, WI), and luminescence was determined using a Victor plate reader (Perkin Elmer, Waltham, MA). 50% inhibition value (IC50) calculations were generated using XLfit (IDBS, Boston, MA) 4 parameter curve fit.

   Click to Show/Hide
In Vitro Model Acute myeloblastic leukemia with maturation, Adult acute myeloid leukemia with maturation HL60 cells CVCL_0002
References
Ref 1 JP2024177330A5 - Google Patents